KEGG   Burkholderia thailandensis E264: BTH_I2261Help
Entry
BTH_I2261         CDS       T00311                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00071  Fatty acid degradation
bte00072  Synthesis and degradation of ketone bodies
bte00280  Valine, leucine and isoleucine degradation
bte00310  Lysine degradation
bte00362  Benzoate degradation
bte00380  Tryptophan metabolism
bte00620  Pyruvate metabolism
bte00630  Glyoxylate and dicarboxylate metabolism
bte00640  Propanoate metabolism
bte00650  Butanoate metabolism
bte00900  Terpenoid backbone biosynthesis
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
bte01212  Fatty acid metabolism
bte02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTH_I2261
   00630 Glyoxylate and dicarboxylate metabolism
    BTH_I2261
   00640 Propanoate metabolism
    BTH_I2261
   00650 Butanoate metabolism
    BTH_I2261
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTH_I2261
   00072 Synthesis and degradation of ketone bodies
    BTH_I2261
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTH_I2261
   00310 Lysine degradation
    BTH_I2261
   00380 Tryptophan metabolism
    BTH_I2261
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTH_I2261
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTH_I2261
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTH_I2261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bte04147]
    BTH_I2261
Enzymes [BR:bte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTH_I2261
Exosome [BR:bte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTH_I2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: ABC37581
UniProt: Q2SWB7
Position
I:2544338..2545522
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGVAQHAPALTLNRLCGSGLQAIVSAAQGVLLGDADIAVAGGAENM
SRAPYAVPSARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAENVAAKYGITRDAQDALA
LESHRRASHATKSGYFKEQILPIEIASRKGAVVFDADEHVRHDASLDDFTKLKPVFVKEN
GTVTAGNASGINDAAAAVVLMERSVAEKRGAKPLARLVSYAHAGVDPAYMGIGPVPATKK
ALERAGITVADLDVIEANEAFAAQACAVSNELGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtagtggtggtgagcggcgtacgcaccgcgatcggcgatttcggcggc
agcctgaaggatttcgcgccgaccgagctcggtgcgcgcgtggtgcgcgaggtgttgtcg
cgcgcgcaggtgtcgggcgacgaagtcggccacgtcgtgttcggcaacgtcgtgcacacg
gaaccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggtggcgtcgcgcagcac
gcgccggcgctgacgctcaaccggctgtgcggctcgggcctgcaggcgatcgtgtcggcc
gcgcagggcgtgctgctcggcgatgcggacatcgcggtcgcgggcggcgcggagaacatg
agccgcgcgccgtatgcggtgccgtccgcgcgcttcggccagcgcatgggcgatgcgaag
ctcgtcgacatgatgatcggcgcgctcaacgatccgttccagtcgattcacatgggcgtg
acggcggagaacgtcgcggcgaagtacgggatcacgcgcgacgcgcaggacgcgctcgcg
ctcgaatcgcaccggcgcgcgtcgcatgcgacgaagtccggctacttcaaggagcagatc
ctgccgatcgagatcgcgtcgcgcaagggcgcggtggtgttcgacgccgacgaacacgtg
cgccacgacgcgtcgctcgacgatttcacgaagctcaagcccgtgttcgtcaaggagaac
ggcacggtgacggcgggcaatgcatcgggcatcaacgatgcggccgccgcggtcgtgctg
atggagcgcagcgtcgccgagaagcgcggcgcgaagccgctcgcgcgcctcgtctcgtat
gcgcatgcgggcgtcgatccggcgtacatgggcatcggtcccgtgcccgcgacgaagaag
gcgctcgagcgcgcgggcatcacggtcgccgatctcgacgtgatcgaggcaaacgaggcg
tttgccgcgcaggcgtgcgcggtgtcgaacgagctcggcctcgatccggcgaaggtcaac
ccgaacggctcgggcatctcgctcggtcatccgatcggcgcgacgggcgcgctcatcacc
gtgaaggcgctctacgagctgcagcgcatcggcgggcgctacgcgctcgtcacgatgtgc
atcggcggcgggcagggtatcgccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system