KEGG   Burkholderia thailandensis E264: BTH_I2358Help
Entry
BTH_I2358         CDS       T00311                                 

Definition
(GenBank) lipase/esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00903  Limonene and pinene degradation
bte00930  Caprolactam degradation
bte01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTH_I2358
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BTH_I2358
Enzymes [BR:bte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BTH_I2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Abhydrolase_2 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABC38006
UniProt: Q2SW20
Position
I:complement(2656540..2657460)
Genome map
AA seq 306 aa AA seqDB search
MIVSWQNWCFSWLSRRTTKSLTRKPALSAHDMRAHSAKWSSRGVKPPRGWRVREMTARPL
CGEWIEPADPVRRDSLRRIVIYLHGGGYCFCSPRTHRTIACALAKGADARTFSLDYRLAP
EHPFPAAVEDALASYRQLLADGASSDRIVIGGDSSGGGLALALLLSLRDAGDPMPAGAVL
FSPWTDLAATGASLKANDEADVMLTAAAVANFSQYYLGGTAADHPIASPLYGEYAGLPPL
FVQASDTEVLLDDAARVAEKARVADVAVDFKVWHRLPHAWPTLTPYLPEAKAAVKEATDF
IRRVVP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgagttggcaaaactggtgcttttcctggctatcgcgtagaacgaccaagtcc
ctgaccagaaaaccggcgctgtccgctcacgacatgcgagcgcacagcgccaaatggtcc
agccgtggcgtgaaacctccccggggctggcgcgtgcgcgaaatgaccgcgcggccgcta
tgtggcgaatggatcgaaccggcggacccggttcgccgcgactcgcttcgccgcatcgtc
atttatttgcatggcggaggatattgcttttgctctccccgcacgcatcgaacgattgcc
tgtgcgttggccaaaggggcggacgcgcgcaccttttcattggattaccggcttgctccg
gaacatccgtttcccgccgcggtggaggatgcattggcctcctatcggcaacttctcgcc
gatggcgcatcttcagaccggatcgtcatcggtggggattcctccggcggggggctcgcg
cttgctctgttgctgtcgttgcgcgatgccggtgatccgatgccggctggcgcggtattg
ttttctccgtggacggatctggccgcgaccggcgcgtccctgaaggcgaatgacgaagcc
gatgtcatgctgaccgcagccgccgtagcgaatttttcccagtattatctgggcggcaca
gctgctgatcaccctattgcttcacctctctatggagaatatgcgggtttgccgcccttg
ttcgtccaggcgagcgacacggaggtattgctggacgacgccgcgcgggtcgcggaaaag
gcccgcgttgccgacgtcgcggtggacttcaaggtctggcatcggcttccgcacgcctgg
cccacgctgacgccttatctgcccgaagcgaaggcggccgtaaaagaggccaccgacttt
attcggagggtggtgccgtga

DBGET integrated database retrieval system