KEGG   Burkholderia thailandensis E264: BTH_I2397Help
Entry
BTH_I2397         CDS       T00311                                 

Definition
(GenBank) precorrin-6Y C5,15-methyltransferase (decarboxylating)
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00860  Porphyrin and chlorophyll metabolism
bte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTH_I2397
Enzymes [BR:bte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     BTH_I2397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_4 Methyltransf_24 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABC39295
UniProt: Q2SVY1
Position
I:complement(2725365..2726885)
Genome map
AA seq 506 aa AA seqDB search
MKAGTNETSRQVSWLAGRHPQRAFPAAAKRAAWPVAWIGCGLAAHSCGGSRSGAARPAFP
LGPRGAPVDGRCIMPFFATPERADARCGRRFQDRREHDGVRRMTAWLTVVGIGDDGYAGL
GRPARRALADAAVVMGGERHLAMLPARHGAERVPWPKPFDLAPLFARAPARVCVLASGDP
MLFGVGATLASTLAPNEWRVLPAPSSLSLAAARIGWPLQDVDAVSLVGRPLASLHRHLYP
GRRLFVLSADGATPAAIAGALAARGFGPSAMTVFEHLGGPLERRADARADAWGDARAAAL
NVVAIECRASADAPRLALTPGLPDDAYRHDGQLTKRDLRALALGRLAPAPGELLWDVGAG
SGSIGIEWMRAHPSCRTIAIEAHPARQRIIEHNRDALGVPALELVAGRAPEALAGLPAPD
AVFVGGGVSREGVLDACWAGLKPGGRLVAHAVTLQGEAALVAWRERHGGALARVSVAHAQ
PLGGFDAWRQALPVMLYDARKPQEHE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctggcacgaacgaaacgtcccggcaggtctcctggctggcaggtcgtcatccg
cagcgggccttcccggcagccgcgaaaagggcggcgtggccagtggcgtggatcggatgc
ggactcgctgctcacagttgcgggggcagccgcagcggcgcggcgcgccctgcgttccct
cttgggccccgtggggcgccggtcgacggacgctgtattatgccttttttcgcgacgccc
gagcgcgcagatgcgcgatgcgggcgtcgctttcaggatcgacgggaacacgatggagta
cgacggatgaccgcgtggctgacggtggttggcatcggcgacgacggctacgcggggctc
ggccggccggcgcggcgcgcgctcgccgacgcggcggtggtgatgggcggcgagcggcat
ctcgcgatgctgcccgcgcggcacggcgccgagcgcgtgccgtggccgaagccgttcgat
ctcgcgccgctcttcgcgcgggctccggcgcgcgtgtgcgtgctggcgagcggcgatccg
atgctgttcggcgtcggcgcgacgctcgccagcacgctcgcgccgaacgagtggcgcgtg
ctgcccgcgccgtcgtcgctgtcgctcgcggccgcgcgcatcggctggccgttgcaggac
gtcgatgcggtgtcgctcgtcggccgcccgctcgcgtcgcttcaccggcatctgtatccg
ggccggcgcctgttcgtgctgagcgcggacggcgcgacgcccgccgcgatcgccggcgcg
ctcgccgcgcgcggcttcgggccgagcgcgatgacggtgttcgagcatctcggcggcccg
ctcgagcggcgcgccgacgcgcgcgccgacgcgtggggcgacgcgcgtgcggcggcgctg
aacgtcgtcgcgatcgaatgccgcgcgagcgccgatgcgccgcgcctggcgctcacgccc
ggcttgccggacgatgcgtaccgccacgacggccagctgacgaagcgcgatctgcgcgcg
ctcgcgctcgggcggctcgcgcccgcgccgggcgaattgctgtgggacgtcggcgcgggc
tccggctcgatcggcatcgaatggatgcgcgcgcatccgagttgccggacgatcgcgatc
gaagcgcatccggcgcggcagcgcatcatcgagcacaaccgagatgcgctcggtgtgccc
gcgctcgagctcgtcgcgggccgcgcgcccgaagcgctcgcgggcctgcccgctcccgac
gcggtgttcgtcggcggcggcgtgagccgtgagggcgtgctcgacgcgtgctgggccggg
ctgaagccgggcggccgcctcgtcgcgcacgcggtcacgctgcagggcgaggcggcgctc
gtcgcatggcgcgagcggcacggcggcgcgctcgcgcgcgtgtcggtcgcgcacgcgcag
ccgctcggcggcttcgacgcgtggcggcaggcgctgcccgtcatgctgtacgacgcccgc
aagccgcaggagcacgaatga

DBGET integrated database retrieval system