KEGG   Burkholderia thailandensis E264: BTH_I2691
Entry
BTH_I2691         CDS       T00311                                 

Definition
(GenBank) hypothetical protein
Organism
bte  Burkholderia thailandensis E264
SSDB
Motif
Pfam: DrsE MIS13
Other DBs
NCBI-ProteinID: ABC38088
UniProt: Q2SV43
Position
I:complement(3077299..3080322)
AA seq 1007 aa
MAGSDDRCDVCKLQGLAVYPSRYAVVPKTFDAPALGPFDDKSVTGVALTQSKYGLRQLRE
GFVYLLYESGPRGPFHWEVYSVAPDGTLWKQLDTASVKRVSAPQACQRKGHSASRVQYLV
IEKPHQCGNVWIAFSEWPWSQDTVKRYGGNDANAASLRKKRMQLIEPSKWISAPKPGPYS
APLTEANLQRVIEHAPAVATTAKGEPVGLLSTELPEAVSYGDLGAFRDARLQICTSRYPW
TMRNKAAAGAKLSPAAETVKHAEGSTRNAKGAPCVPMMVALWDGIGITHELNGFRNDAQA
RFLQYCDEQALRINALQWIDQAKLAVEAGARRKATFDHSPATPGSTSWYYPDAVAKQKAA
AKTPADQRFWSDYQWMGENGVPPSYARQITQFRAAPSSPAYQDAMARARKYVEAKPRIEQ
DRAKKIDQDTVTGTEHDWAKYREKLADDTSGKKGASNGNVKRIDVFRILYQRIQDQKQAL
LAQRTADVANWLDAPLFLAALEDYHEENGFDGIAFEFAIFHAIVGLSAERSGVAALNKLI
DRLDPTKPESLVWRMVASNQKKSKEALKLALAKAEANKNVVLETVGEGFNVFAETSEKLK
KFAEFYTKMDEMSKQAKQLNAIDQAMHDKGVDKVVVSVGHLVFQRFPYKGADLMGLGNGV
SEAIIKSVFMLRVGIKSEEVKDLVLQQAKVEPQLRSKFLGEYQAQRRMGRSSPEAFRMAT
SAVAKTEGSNVLANRWSKLKVRESVGLVGVIGLIEVIGLIKLINKSDKEGRDWAELGGAC
FSVAGAAAEVALKPLEAFKFEEGAKNLKIFGGYCGALAAGVGTTLDTLDAIEKWGSGERL
VSVLYFMKGMLGFGTTMAFGLTALSSSAPVFERLASNITGRQIRIVILDRIGQGITDAAA
RKVAIAAGERVATVAAERVGAMVVGRGLLIMASWQIQVAIISLQFVIWYFGNDDLQNSIK
DSIFGVGGKYKNTEDLKKQNEAFDKALVAVGFKDDTASDKEEAKSHR
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggcgggaagcgacgatcgttgcgacgtttgcaagcttcaggggctggcggtctatccg
tcgcgctacgcggtggtgccaaaaaccttcgacgcgccagcgctcggaccattcgacgac
aagagcgtcacgggcgtggcgctcacgcaaagcaagtacggcttgcgtcaactccgcgag
ggcttcgtctatttgctctacgaatcgggccctcgcggcccgtttcattgggaagtgtat
tcagtcgcgccggacggcacgctctggaagcagctggatacggcgagcgtgaagcgggtg
agcgctccacaggcttgtcagcgaaaggggcatagcgcgtcgcgtgtccagtatctcgtc
atcgagaaaccacatcagtgcggcaatgtctggatcgcgttcagcgaatggccgtggagc
caagacacggttaagcgttacggcggcaacgacgcgaacgccgcgagtctgcgcaagaaa
cgcatgcaactgatcgagccttcgaagtggatatcggcgccgaagccggggccgtattcg
gcgccgctgacggaggccaatctgcagcgtgtcatcgaacacgcgcctgctgtcgcgacc
acggcgaaaggcgaacccgtcggcttgctcagcacggaactgccggaggcggtcagctac
ggggacttgggcgcgtttcgcgacgctcgcctgcaaatttgtacgtcgcgctacccatgg
accatgcgcaacaaggctgcggcgggtgcaaagctgagcccggccgcggaaacggtcaag
cacgcggagggcagtacccgaaacgcaaagggtgcgccgtgcgtgccgatgatggtggcg
ctgtgggacggcatcgggatcacgcacgaactgaacggcttccgcaacgatgcgcaggcg
cgctttctgcagtattgcgacgagcaggcgctccgaatcaacgcgctgcaatggatcgat
caggcgaagctcgcggtggaagccggtgcgcgcagaaaggcgacgttcgatcatagcccg
gccacgccgggcagcacgagctggtattacccggatgccgtcgcgaagcaaaaggcggcg
gcgaagactccggcggatcagcggttctggagcgactatcagtggatgggggaaaacggc
gtaccgccgtcatacgccagacagatcacgcagtttcgcgcggcgccgtcttcgccggcc
tatcaggatgcgatggcgagagcgcgcaagtatgtcgaggccaagccgagaatcgagcag
gatcgcgcgaaaaagatcgaccaggacaccgttaccggaaccgagcacgattgggcgaag
tatcgcgagaaattggcggacgatacgtcgggcaagaagggggcgtccaacgggaacgtc
aaacgtatcgacgtctttcgcatcctgtaccagcgtatccaggaccagaagcaagcgttg
ctcgcgcagcggacggcggatgtcgcgaactggctggatgcgccgcttttcctggcggcg
ctggaggattatcacgaagagaacggcttcgacgggattgcgttcgagtttgccattttc
catgcgatcgtcggattgagcgccgagcgaagcggcgtggccgcattgaacaagctgatc
gatcgcctggatccgacgaagccggagagcctcgtttggcgaatggtggcgagcaaccag
aagaaatcgaaggaagcgctgaagcttgcgctcgcgaaggcggaggcgaacaagaacgtc
gtactggagacggtcggcgaaggattcaacgtattcgcggaaacgtccgaaaagctgaag
aagttcgccgagttttacacgaagatggacgaaatgagcaagcaggccaaacagctcaac
gccattgatcaggcaatgcacgacaagggcgtcgacaaggtggtcgtcagtgtcgggcat
cttgtttttcagcgctttccgtacaagggggccgatttgatgggccttggaaacggcgtg
agcgaggcgatcatcaagtccgtgttcatgctgcgggtcggcatcaagagcgaagaggtg
aaggacctcgtcttgcagcaagccaaggtggagccgcagcttcggagcaagttcctcgga
gagtaccaggcgcagcgccgaatgggacgcagttcgccggaagccttccggatggccacg
tcggctgttgccaagaccgaaggctcgaacgtgctggccaatcgctggagcaagctcaag
gtgcgcgagagtgtcggccttgtgggcgtgatcgggctgatcgaagtgatcgggttgatc
aagctgattaacaagagcgacaaggaagggcgggattgggctgaattgggcggcgcatgt
ttttcggtggcgggcgctgcggcggaggttgcgctcaaacctctggaagcattcaagttt
gaagaaggagccaagaatctgaagatttttggtgggtattgcggggccctggctgctgga
gtagggacgactttggataccttggacgccatagaaaaatggggaagcggtgaaagactt
gttagtgttctttacttcatgaagggcatgctcgggtttggcacgacaatggcgtttggc
ttgacggcgttgagctcatccgcaccggtttttgaacgtcttgcgtccaatatcactggg
aggcagattcgtatcgttattctcgatcggatcggtcaaggtatcactgacgcagcggca
cgtaaggtcgcgatagcagccggagagcgagtcgcaaccgtagcagcagagcgagttggg
gcaatggtggtgggcagaggtctgctgattatggctagttggcaaatccaagttgctatt
atttcgcttcaatttgttatttggtactttggaaatgatgatcttcagaattcaataaaa
gactccatttttggggttggcgggaaatataaaaatacagaagatttaaaaaaacagaat
gaggctttcgataaagccctggtggctgttgggtttaaggatgacactgcttctgataag
gaagaggcgaaatcgcatagatga

DBGET integrated database retrieval system