KEGG   Burkholderia thailandensis E264: BTH_I2698
Entry
BTH_I2698         CDS       T00311                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bte  Burkholderia thailandensis E264
SSDB
Motif
Pfam: DUF2235
Other DBs
NCBI-ProteinID: ABC38949
UniProt: Q2SV36
Position
I:complement(3089237..3091639)
AA seq 800 aa
MNFRFAPAERPDIGVVTKEEKDAILRRLHDDDGMSCCKTLHIGIFFDGTRNNAERDKSGH
KHSNVARLRDAFPQDRYHKSIYVAGVGTPFSSEIGDYGIGLQAVAGASAGWAGEGRINWA
LLQIHNAVHECAFRVGLSTALGVDDKNLVKLMSLDMNFKGIDLGGNAPQPGSTGDIKSRS
SPGIGALKLIAAEQYGAELTWDKDTNWSQLKDDLDSSKWAAAVRAWDGRRRKILGDRRAQ
LKARVGDMLVKGKPRIQRIRLYVFGFSRGAAEARTFSNWLVDALESDFSLCGVPVSYDFL
GIFDTVASVGIAQSAAATLFDGHGGWARKELMAVPHYVRRCVHMVAAHEPRGSFPLDLID
CSLEGREEIVYPGVHSDVGGGYGPAEQGRGRGDADKLSQVPLVDMYRAARIAGVPLDIQG
PGITSEAADVFKISAGLKQAFTAYVKASEGYYYAKEHGTAGLMRAHYGLYLRWRRMRLKD
MSLQPSFKAAQANCPQDAMDIDSANKELRAEWEDLLEIEKEGGPSVAHYAKKFGAKVARD
NPKIVASVSAVLLPGVIVFSTRPEVIYGVRKAGDRVTELVRAQLQEKWEQWQQVRSDWNM
GPPEAPISALYDNYMHDSRAWFKPLGDDDDVWNYKQIQELKSKQASFEREHAAWRKRAET
GAPGPWQIAQAMSAGASGLGPIAMQPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAAKD
PNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEEME
GMRMQMQRQVDMKGIGVLFQ
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgaattttcgctttgctccggccgaacgccccgacataggcgttgtgacgaaagaagaa
aaggacgcgattcttcggcggcttcatgacgacgatggtatgagttgttgtaaaactctt
cacatcggaattttcttcgacggtacgcgtaacaacgcggaaagggacaagtcagggcat
aagcacagtaacgtggctcgccttcgggacgcgtttcctcaagatcgatatcacaagtcc
atttacgtcgctggggtagggacacctttctcaagcgaaatcggtgattatggtatcgga
cttcaagccgtggctggcgcatctgccggatgggctggcgaaggacgtattaactgggcc
ttattgcaaatccataatgcagtgcacgaatgtgctttccgtgttggtcttagtaccgcg
ctcggggtggacgacaagaatttggtgaagttgatgagcctagacatgaacttcaagggc
atcgacctgggtggaaatgctccccaacctggtagtacaggtgacattaaatcgcgatcg
agccctggcatcggtgcgctcaagttgatcgcggccgaacagtacggcgcggagttgacg
tgggacaaggatacgaactggtcccagttaaaggatgatctggattcgtcgaaatgggcg
gcggctgtgcgggcgtgggacggtagacgccgcaagattttgggcgatcgtcgtgcgcag
ttgaaggcgcgggtcggcgacatgcttgttaagggcaagccgagaatccagcgcattcgc
ctttatgtgtttggattttcgcggggtgcagcggaagctcgcacgttttcgaattggctt
gtcgatgcactcgaatccgatttcagcctgtgtggtgttcccgtctcgtacgatttcctt
ggaattttcgatactgtcgcgtcagtcggcattgcgcagagcgccgccgcgacacttttc
gatgggcacggcggttgggcgcgtaaggaattaatggcggtgccgcactatgtccgccgc
tgcgtgcatatggtcgctgcgcatgagccgcgcggctcgtttccgctcgatctgatcgac
tgttcgttggaagggcgagaggaaattgtgtatcccggcgttcactcagatgtggggggt
ggttacggaccagccgagcagggacgaggacgaggcgatgccgataagttgtcgcaagtt
ccactcgttgacatgtatagagcggcacgtatcgccggcgtaccgctcgatatacaagga
ccgggcatcacgtcggaagcggccgatgtatttaagatctccgctggactcaagcaagcc
tttactgcctatgtcaaggcaagtgagggctactattacgcgaaggagcatgggacagcg
ggtttgatgcgagctcattatggtttgtatctgcgctggcgcaggatgcgtctcaaggat
atgagcttgcagccgagtttcaaggctgcgcaggcgaattgtccgcaagacgctatggat
atcgacagtgcgaataaggaattaagggcggaatgggaagatctgctggagattgaaaag
gagggaggcccgagtgtggcccattatgcaaagaagtttggagcgaaagtggctcgagac
aatcctaaaattgtcgcatccgtctcggccgttcttttgccgggggtcatcgtcttcagt
actcgtcctgaagttatttacggggtgagaaaggccggtgatcgcgtgacagaactagtc
cgcgcccagcttcaagaaaaatgggagcaatggcagcaagtccgcagcgactggaacatg
ggcccgcccgaagcgccgatcagcgcgctgtacgacaactacatgcacgactcgcgagca
tggttcaagccgctcggcgatgacgacgacgtctggaactacaagcagatccaggagctg
aagtcgaagcaagcgagcttcgagcgcgagcacgccgcatggagaaaacgcgccgaaacg
ggcgcgccggggccgtggcagatcgcgcaggcgatgagtgcgggggcgtccggactcggg
ccgatcgcaatgcagcccgaacccgaaccccgctccccgctcaccgcccagcaagccgat
ttgctcaagcgctacgacgccgcgatgcagtccgcgaagcaggcgcgcgccgcgaaggac
ccgaacgcgccgacggacagcgccgtgctcaccgatccgaaagtgacgggcggcctcgcg
ttgcaaaccagcggccgcgagttctatttcctgtggggcttcctgcgctggcgaaccgtg
ttcgtgaacggcgtgcgctgggaccagccgcgcgtgccgacagtgcaggaggaaatggag
ggcatgcgcatgcagatgcaacgccaggtcgacatgaagggcatcggcgtactgttccaa
tga

DBGET integrated database retrieval system