KEGG   Burkholderia thailandensis E264: BTH_I2775Help
Entry
BTH_I2775         CDS       T00311                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00790  Folate biosynthesis
bte01100  Metabolic pathways
Module
bte_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTH_I2775
Enzymes [BR:bte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BTH_I2775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABC37580
UniProt: Q2SUW2
Position
I:complement(3187552..3188550)
Genome map
AA seq 332 aa AA seqDB search
MRLSFTGWCGCHTGPFCFLVRRFSSLPIAFDPTLQLVSSPDPVFSIPEPLQCGRFTLTFE
RPLVMGILNVTPDSFSDGGRYVARDAALAQAERMLAEGADIIDIGGESTRPGAPPVPLDE
ELERVIPLVEALRGMSVPLSIDTYKPAVMRASLAAGADLINDIWGLRQPGAIDAVRDSAC
GLCVMHMLGEPRTMQVHEPDYRDVVADVRAFLAERVDALVQAGIDARRISVDPGFGFGKA
VIEHNYALLAHLPRTAPARPGGRAYPILAGMSRKSMLGALIGKPAPERVAASVAAAVCAL
ERGAAIVRVHDVAATVDALKVWSAVRDAARRA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgcggctttcgttcacgggctggtgtggctgtcacaccggcccgttttgctttcttgtc
agacgcttttcatcgcttcccatcgcgttcgatccgacgcttcagctcgtgtccagtccc
gatcccgttttttccattcccgaaccgctgcagtgcggccgcttcacgctgaccttcgag
cggcccctcgtgatgggcatcctcaacgtcacccccgattcgttttcggacggcggacgt
tacgtcgcccgagacgccgcgctcgcgcaggcggagcggatgcttgccgagggcgccgac
atcatcgacatcggcggcgaatcgacgcgtcccggcgcgccgcccgtgccgctcgacgag
gaactcgagcgggtgattccgctcgtcgaagcgctgcgcggcatgagcgtgccgctgtcg
atcgacacgtacaagcccgccgtgatgcgcgcgtcgctcgcggccggcgccgatctgatc
aacgacatctggggcctgcggcagccgggcgcgatcgacgcggtgcgcgacagcgcgtgc
ggcctctgcgtgatgcacatgctcggcgagccgcggacgatgcaggtgcacgagcccgac
tatcgcgacgtggtcgccgacgtgcgcgcgtttctcgccgagcgcgtcgacgcgctcgtg
caggccggcatcgatgcccggcgtatcagcgtcgatccggggttcggtttcggcaaggcg
gtgatagaacacaactatgcgctgctcgctcatttgccacggacggcgcccgcgcggccc
ggcggacgggcgtatccgattctcgccggcatgtcgcgcaagtcgatgctgggcgcgctg
atcggcaagcccgcgcccgagcgcgtcgcggcgagcgtcgccgcggcggtttgcgcgctc
gagcggggcgcggcgatcgtgcgcgtgcatgacgtcgccgcgaccgtcgacgcactgaaa
gtatggagcgccgtgcgcgatgccgcgcggcgagcataa

DBGET integrated database retrieval system