KEGG   Burkholderia thailandensis E264: BTH_I2899Help
Entry
BTH_I2899         CDS       T00311                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00071  Fatty acid degradation
bte00280  Valine, leucine and isoleucine degradation
bte00281  Geraniol degradation
bte00310  Lysine degradation
bte00360  Phenylalanine metabolism
bte00362  Benzoate degradation
bte00380  Tryptophan metabolism
bte00410  beta-Alanine metabolism
bte00627  Aminobenzoate degradation
bte00640  Propanoate metabolism
bte00650  Butanoate metabolism
bte00903  Limonene and pinene degradation
bte00930  Caprolactam degradation
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01212  Fatty acid metabolism
Module
bte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BTH_I2899
   00650 Butanoate metabolism
    BTH_I2899
  Lipid metabolism
   00071 Fatty acid degradation
    BTH_I2899
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTH_I2899
   00310 Lysine degradation
    BTH_I2899
   00360 Phenylalanine metabolism
    BTH_I2899
   00380 Tryptophan metabolism
    BTH_I2899
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTH_I2899
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTH_I2899
   00281 Geraniol degradation
    BTH_I2899
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTH_I2899
   00627 Aminobenzoate degradation
    BTH_I2899
   00930 Caprolactam degradation
    BTH_I2899
Enzymes [BR:bte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BTH_I2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABC39084
UniProt: Q2SUJ3
Position
I:complement(3333869..3334645)
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLITLNRPKALNALNDALMDELGAALKVFDADEGIGAIVLTGSEKA
FAAGADIGMMATYSYMDVFKGDYITRNWEAVRQVRKPVIAAVAGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVLPGAGGTQRLPRAVSKAKAMDMCLTARFMDAEEAERAGLVSRI
LPADKLLDEAIAAASTIAEFSLPAVMMVKEAVNRAYETTLSEGVHFERRLFHSAFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacatcctggtggagacgcggggccgggtgggactgattacgctgaat
cgtccgaaggcgctgaatgcgctgaacgacgcgctgatggacgagctcggcgcggcgctc
aaggtatttgatgcggatgagggtatcggcgcgatcgtgctgacgggcagcgagaaggcg
ttcgcagctggcgccgacatcgggatgatggcgacctattcgtatatggacgtcttcaag
ggcgactacatcacgcgtaactgggaggcggtgcgtcaggttcgcaagccggtcattgcg
gcggtggcgggtttcgcgctgggcggcggctgcgagctcgcgatgatgtgcgacatcatc
tttgcggccgataccgcgaaattcggccaacccgaaatcaagctcggcgtgctgccgggg
gcgggcggcacgcagcgtctgccgcgggcggtatcgaaggcgaaggcgatggacatgtgc
ctaaccgctcgcttcatggatgcggaggaggccgagcgcgcggggctggtgtcgcggatt
ctgccggccgacaagttgctcgacgaagcgattgccgcggcgtcgacgatcgccgagttc
tcgttgcccgccgtgatgatggtgaaggaggcggtgaatcgcgcgtacgagacgaccttg
tccgaaggggtgcacttcgagcgccgcttgtttcattcggcgtttgcaactgaagatcag
aaggaaggcatggcggcgttcgtcgagaagcgcaagcccgtcttcaagcaccgctga

DBGET integrated database retrieval system