KEGG   Burkholderia thailandensis E264: BTH_I2906Help
Entry
BTH_I2906         CDS       T00311                                 

Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BTH_I2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABC38776
UniProt: Q2SUI6
Position
I:complement(3342085..3342642)
Genome map
AA seq 185 aa AA seqDB search
MSGKRVGSVAIRKNAILPPRRAAPGCGPGPHQAECRTKAARRPCGAGASAAAAAGDLDGT
TMSQYRFSVSVKTSYLPEQSDPERRQYAFAYTLTIRNTGQVAAQLIARHWIITDSENQVQ
EVKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHM
PRTLH
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaagcgcgtggggagcgttgcgatacggaaaaacgccattctaccgccgcgg
cgcgcggcgcccggttgcgggccggggcctcatcaagcagaatgccgaaccaaagcggcg
cgtcggccgtgcggggcgggcgcctcggcagcggctgcggcgggcgacctcgacgggacc
accatgagccagtatcgattcagcgtatcggtgaagaccagctatttgccggaacaatcc
gaccccgaacgccgtcaatacgcattcgcgtacacgctgacgatccgcaatacagggcag
gtggcggcgcaactgatcgcccggcactggatcatcacggatagcgagaaccaggttcag
gaggtcaaggggctcggcgtcgtaggccatcagccgttgctgcagccgggcgagcagttc
gagtacacgagttgggccgtgatcgcgacgcctgtcggcacgatgcgcggcgcgtatttt
tgcgtcgcggaggacggcgagcgcttcgaggcgcccgtcgacgaattcgcgctgcacatg
ccgcgcacgctgcactga

DBGET integrated database retrieval system