KEGG   Burkholderia thailandensis E264: BTH_I2968
Entry
BTH_I2968         CDS       T00311                                 

Definition
(GenBank) ompA family protein, putative
  KO
K11892  type VI secretion system protein ImpK
Organism
bte  Burkholderia thailandensis E264
Pathway
bte03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bte00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BTH_I2968
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_I2968
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_I2968
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ABC38450
UniProt: Q2SUC4
Position
I:3415532..3416317
AA seq 261 aa
MSYAPSLFGGNTPPPAPHTVSSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFST
RIQEFLGEFERGAKKLNIAADDVYAAKFAFCAAIDESVLSSQFKIRADWERRPLQLVLFG
EQLAGEKFYQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEI
ANMKGKRAPFAPHWPLPDQISHRLKREVPLWAIGAVFALVGLLAFVGLNTYLKDSTVRAL
APYSQVIKVGPESANLTISLP
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagttacgcgccttccctcttcggcggcaacacgccgcctcccgcgccgcacacggtg
tcgtcgaccgacgccggcttccaggcacgctcgctcgtcgatctgctgtacgacggcttc
ttcatgctgttcctgctgaagaacggccgcgaaccgaacgacgcgtcggaattcagcacg
cgcattcaggagttcctgggcgaattcgagcgcggcgcgaagaagctcaacatcgccgcc
gacgacgtctacgcggcgaagttcgcgttttgcgcggcgatcgacgaatcggtgctgtcg
tcgcagttcaagatccgcgcggattgggaacgccggccgctgcaactcgtgctgttcggc
gaacagcttgcgggcgagaagttctatcagtacctcgaagaatgccgcgcgcagggcgcg
gcacggctgcagtcgctcgaggtgttccatatgtgcctgctgctcggcttccagggcaag
tatctgctcgaagggccggagaagctcgcgtatctgaccgcgcggctcggcgacgagatc
gcgaacatgaagggcaagcgcgcgccgttcgcgccgcattggccacttccggatcagatc
tcgcaccggctcaagcgcgaggtgccgctgtgggcgatcggggcggtgttcgcgctcgtc
gggctgctggcgttcgtcgggttgaatacgtatttgaaggacagcaccgtgcgggcgctc
gcgccttattcgcaggtcatcaaggttgggccggagtcggctaatttgacgatttcgttg
ccttga

DBGET integrated database retrieval system