KEGG   Burkholderia thailandensis E264: BTH_I3225
Entry
BTH_I3225         CDS       T00311                                 

Definition
(GenBank) Rhs element Vgr protein, putative
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bte  Burkholderia thailandensis E264
Pathway
bte03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bte00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BTH_I3225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_I3225
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_I3225
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Desulfoferrod_N
Other DBs
NCBI-ProteinID: ABC36513
UniProt: Q2STN0
Position
I:3671318..3674098
AA seq 926 aa
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQGALGHLLALQHASVQEGLMTGIGGRLTCV
STRRDIPPGVFLGMPVSIRLITDRGQPHMVNAIISDVQIGQSDGELCVYQLTVCDALSLM
DKRTNSRVFRKRSVIDVLATLFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNES
DAHFVRRLLRREGITVFAKAGPAKGEQPLQGDATVHTLVCCDEPMSLPQAPAGTVRLHPR
DAGTEQRDTVTLFALRRQLVPGKAGRPSWDYKKARIDESSVASSLDQGEAGNDLAKLLTD
IAIDIPHAGDSWSDHERLTRARMLAHEFEAERYDGVSSVRDLAVGAWITLTGDPDWDRQL
ADKRQFVITSIDHDIWNNLPKGLNDRVHALFAASRNLVNAPGALPAALANDADTRYENTF
TCVRRGVPLAPAYDPQADLPPVHLLTGTIVGAEGEEVFCDENGRVRVRVHGLDPADHAHA
QGAGTNDNAGDSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGA
NPPATFSHAGGLPGNRYLSGIKTKEIKGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGY
LTQPRENGHGNDRGEGAELRTDAAAALRAAQGILLTTYARTQASGGQLDRDELIRLLGEC
SELFKALGDYAGQHGGQAADTAGQHAVAAAFRNWTPGAGGADAPPDGGDRALMAFGAQAG
SVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAVAGEGPML
LQAQADTLTANAQKGVKITTNEHEVFVSAPRIRLVAEDGSYLEIGNGITLGTNGDIKLLS
ASHQWGGPSTAQAAKTAFDNQPTDQRFKLHYPGEDGDLPAAANKPFRITLNDGRVIEGKT
DASGLTDLVKDDAMRIAKIDYLKPKL
NT seq 2781 nt   +upstreamnt  +downstreamnt
gtgaccaatttgaacgatacgctacgcaattttgcgtcgggggcggtcgactggaataaa
cgtccggtcgcgttgcactttggcgccgcgcaaggcgcgctgggccacctcctcgcgttg
caacacgccagtgttcaggaaggtctgatgaccgggattggcgggcgattgacctgtgtt
tcgacccgtcgcgacatcccacccggcgtgtttctcggcatgccggtctcgatccggctc
attaccgatcgcggacagccgcacatggtgaacgcgatcatcagcgacgtccagatcggc
caaagcgacggcgagctctgtgtgtaccagctgacggtctgcgacgcgctgtcgctgatg
gacaagcgcaccaattcgcgggtcttccgaaagcgcagcgtcatcgatgtgctcgccacg
ctgttcaacgaatggcagcagcgcagcccggccctcgcgcgcgcattcgaattcgatctg
tccggcttgcgcgccgatcgctatccgccccgcgaactgacccggcaagtcaacgaatcg
gatgcgcatttcgtgcgccgtctgctgcgccgcgaagggatcaccgtgttcgcgaaggcg
gggccggcgaagggcgaacagccgttgcagggcgatgcgaccgtgcacacgctcgtgtgc
tgtgacgagccgatgtcgctgccgcaagcgccggccggcacggttcgcttgcatccgcgc
gacgccggcaccgagcagcgcgacacggtcacgctgttcgcgctgcgtcggcaattggtg
cccggcaaggccggacgcccgtcgtgggactacaagaaggcgcggatcgacgaatcgagc
gtcgcttcgagcctcgatcagggcgaggcgggcaacgatctggcgaagctgctgaccgac
atcgcgatcgacattccgcacgcgggcgattcatggagcgatcacgagcggctcacccgc
gcgcgcatgctcgcgcacgagttcgaggccgagcgctacgacggcgttagcagcgtgcgg
gatctggccgtgggcgcgtggatcacgctgacgggcgatccggactgggacaggcaactc
gccgacaagcgccagttcgtgatcacgtcgatcgatcatgacatctggaacaacctgccg
aaggggctcaatgaccgcgtgcacgcgctgttcgccgcgagccgcaatctcgtgaacgcg
cccggcgcgctgccggccgcgcttgcgaacgacgcggatacgcgctacgagaacacgttc
acctgcgtgcgccgcggcgtgccgcttgcgcccgcgtacgatccgcaagccgatttgccg
cccgtgcatctgctcacgggcacgatcgtcggcgcggagggcgaggaagtgttctgcgac
gaaaacggccgggtgcgcgtgcgggtgcacggcctcgacccggcggaccacgcgcacgcg
cagggcgcgggcaccaacgacaacgcgggcgacagcgcgccgatccgcgtggcgtcgagc
ctcgccggcgcccatttcggcgcatcgtttctgccgcgagtcggcatggaagtcctcctc
ggctgtctcggcggcgatccggaccggttggtgatcatcggcgtgctcggtaacggcgcg
aatccgccggcgacgttcagccatgcgggcggcttgccgggcaaccgctacctgtccggc
atcaagacgaaggagatcaaggggcagcggtacaaccagctgcgtctcgacgacacgccg
aaccagatcagcgcgcaactggcgagcgagcatgcgcattcgcagctcaatctcggatac
ctgacccaaccgcgcgagaacggtcatggcaacgaccgcggcgagggcgcggagctgcgt
accgacgcggcggcggcgctgcgggcggcgcaaggcattctgctgacgacctacgcgcgc
acgcaggcgagcggcgggcaactggaccgtgacgagctgattcggttgctcggcgagtgc
tcggagctgttcaaggcgctgggcgactacgcggggcagcacggcgggcaggctgcggat
acggccggccagcacgcggtggccgccgccttcaggaactggacgccgggcgcgggcggc
gccgatgcgccgcccgacggcggagatcgcgcgctgatggcgttcggcgcgcaggccggc
tcggtgaacgtcacgccgaagacgcacgtgacgtatgccggagagaacatcgatcaggtt
gcgcagcagcacctgcaactgatgagcggccagcggctgaacgcgacggccgggcagggc
atgcaactcttcgcgcggggcgcgggcgtgcaggccgtggcgggcgaagggccgatgctg
ctgcaggcgcaagccgatacgttgacggcgaatgcgcagaagggcgtcaagatcacgacg
aacgagcacgaggtgttcgtgagcgcgccgaggattcggctcgtcgccgaggacggcagc
tacctcgagatcggcaacggcatcacgctcggcacgaacggcgacatcaagctgctgtcg
gcgtcgcaccagtggggcgggccgtcgacggcgcaggcggcgaagaccgcgttcgacaac
cagccgacggatcagcgtttcaagctgcactatccgggcgaggacggcgatttgccggct
gcggcgaacaagccattccggatcacgctgaacgacgggcgcgtcatcgagggcaagacc
gatgcgagcggcctgacggatctggtcaaggacgacgcgatgcgtatcgcgaagatcgac
tatctgaaaccgaagctttga

DBGET integrated database retrieval system