KEGG   Burkholderia thailandensis E264: BTH_II0137
Entry
BTH_II0137        CDS       T00311                                 

Definition
(GenBank) Protein of unknown function (DUF1316) subfamily, putative
  KO
K11897  type VI secretion system protein ImpF
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_II0137
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_II0137
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABC36012
UniProt: Q2T910
Position
II:complement(164085..164603)
AA seq 172 aa
MRHPEGRHRAAYLPSLLDRLQDDAPHSFSESPDAYAPSADEMRRIVQRDLSLLLNTSNLD
DEVDAGRYPLVAASVVNYGVPPLSGSYLHDPNRETIDRLVRTAIVHFEPRLIADSLAIRP
LAAQQGASYNKLTFEISALVQWSPYPLELRIQSTFDLELNRVTLDKTTLNGK
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcggcatcctgaaggacggcatcgggccgcctaccttccgtcgctgctcgaccggctg
caagacgacgcgccgcattccttcagcgaatcgcccgacgcctatgcgccaagcgccgac
gagatgcgtcgcatcgtccagcgggatctgagcctgctgctcaacacgagcaatctggac
gacgaagtggatgccggccgctatccgctcgttgcggcctccgtcgtcaactatggcgtg
ccgccgttgtcgggcagctacctgcacgacccaaaccgggaaacgatcgatcgcctcgtg
cgcaccgcgatcgttcatttcgagccgcgactcattgcggactccttggcgatcaggccg
ctcgcggcgcaacagggcgccagctacaacaaactgacgttcgaaatcagcgcgctcgtg
caatggtcgccgtatccgctggagttgcgcatccagagcacgttcgacctcgagttgaat
cgagtcacgctcgacaagacaacgctcaacggaaaatga

DBGET integrated database retrieval system