KEGG   Burkholderia thailandensis E264: BTH_II0162Help
Entry
BTH_II0162        CDS       T00311                                 

Definition
(GenBank) protein-glutamate methylesterase CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte02020  Two-component system
bte02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bte00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTH_II0162
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BTH_II0162
Enzymes [BR:bte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BTH_II0162
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     BTH_II0162
Two-component system [BR:bte02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BTH_II0162
Bacterial motility proteins [BR:bte02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BTH_II0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABC34755
UniProt: Q2T8Y5
Position
II:196955..198037
Genome map
AA seq 360 aa AA seqDB search
MTEFSSKERYTMIRVLVIDDSATMRILLKKLIDKNEHMECVGVAPNPVAAQELLRETRPD
VITLDIEMPKMNGLDFLDRIMRLMPVAVIMISTLTEAGSESALRALELGAIDFIAKPKLD
FAEGVQAYAEEIYRKIETAGRAKVKKLTRDVPPVRMDAEPPAKPLLAEAGKDGRVVAVGA
STGGTEAVKELLLSLPADCPPLLIAQHMPEPFMRSLAKRLDLLCAMRVKMAEDGETLRRG
CVYIAPGHSNLTIDATAAGYVCRIVRNAGEAQSDSSVDELFRSVAAAAGARGVGIVLTGS
GSDGAAGARAMMAAGAFNIAQDAETSVVYSMPDAAIAACGINEVLPLEKIAGKLMELDGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgacagaattttcatcgaaggaacgatacacgatgattcgcgtactggtgattgacgat
tccgcgacgatgcggatcttgctgaagaagctcatcgacaagaacgagcacatggagtgc
gtgggcgttgcgcccaatccggtggcggcccaggaactgctccgggaaacccggccggac
gtgattacgctcgatatcgaaatgccgaaaatgaacggcctcgatttcctcgatcgcatc
atgcggctgatgccggtcgcggtgatcatgatctccacgctgaccgaggcgggctccgaa
tcggcgctgcgcgcacttgaactgggcgcgatcgacttcatcgcgaagccgaagctcgat
ttcgccgaaggcgtgcaggcgtacgcggaagaaatctatcgcaagatcgagacggccggg
cgagccaaggtgaagaagttgacgcgcgacgtgccgcccgtgcggatggacgccgaaccg
cccgccaagccgctgctcgcggaggcgggcaaggacggccgcgtcgtggcggtgggcgcc
tcgacgggcggaaccgaagcggtgaaggagctgctgctgagtcttccggcggattgtccg
ccgctgctgatcgcgcagcatatgcccgagccgttcatgcgttcgctcgcgaagcgcctc
gacctgctgtgcgcgatgcgcgtcaagatggcggaggacggcgagacgcttcgccgcggt
tgcgtctatatcgcgccggggcattcgaacctgacgatcgacgcgacggcggccgggtat
gtgtgccggatcgtccggaacgcgggcgaggcgcagtcggactcgtccgtcgacgagctg
ttccggtccgtggcggccgccgccggcgcgcgcggcgtgggcatcgtgctgactggcagt
ggttcggacggcgcggccggggcgcgcgcgatgatggcggccggcgcgttcaacatcgcg
caggatgccgaaacgagcgtggtctacagcatgccggacgcggcgatcgccgcttgcggc
atcaacgaagtcctgccgctcgagaagatcgccggcaagctcatggagctcgacggcgca
tga

DBGET integrated database retrieval system