KEGG   Burkholderia thailandensis E264: BTH_II0251
Entry
BTH_II0251        CDS       T00311                                 

Definition
(GenBank) lipoprotein, putative
  KO
K11906  type VI secretion system protein VasD
Organism
bte  Burkholderia thailandensis E264
Pathway
bte03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bte00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BTH_II0251
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_II0251
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_II0251
SSDB
Motif
Pfam: T6SS-SciN DUF4893
Other DBs
NCBI-ProteinID: ABC34811
UniProt: Q2T8P6
Position
II:305598..306116
AA seq 172 aa
MRLRFSGSVALGGALLLAGCGATERSVAVPYSIALDVAPDVNPDINRKPSPIVLKVFQLK
TASAFESADFFSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRV
LEKNRWRMTVPLPRAKQLNLYRFWQTSPSEMKLQVAVKNGGIGLGGDSRVRR
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcgactgcgattcagtggttccgtcgcgctgggaggcgcgctgctgctcgccgggtgc
ggtgcgaccgagcgttccgttgcggtgccgtattcgatcgcgctcgacgtcgcgcccgac
gtcaatccggacatcaatcgcaagccgtcgccgatcgtgctgaaggtgttccagttgaag
acggcgtccgcgttcgagagcgccgatttcttctcgctgcaggacaagccgcagagcgtg
ctcggcgcggatctgctcggcgtcgaccggatcatcctgcggccgggcgatgcgcgcacg
ctgcactatcgcggcaacgtcgacgcgggcgcgatcggcatcgtcgccgaataccgcgtg
ctcgagaagaaccgctggcggatgacggtgccgctgccgcgcgcgaagcaactgaacctg
taccgattctggcaaacctcgccgagcgagatgaagctgcaggtcgccgtgaagaacggc
ggcatcggcctcggcggcgattcgcgagtacgtcgatga

DBGET integrated database retrieval system