KEGG   Burkholderia thailandensis E264: BTH_II0258
Entry
BTH_II0258        CDS       T00311                                 

Definition
(GenBank) Protein of unknown function (DUF770) superfamily
  KO
K11901  type VI secretion system protein ImpB
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_II0258
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_II0258
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABC35572
UniProt: Q2T8N9
Position
II:317322..317903
AA seq 193 aa
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERRVQLPFVMGVIADLAGKRAEPLPD
LPERKFLEVDVDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNV
DALRRLLEARTELSNLLSYMDGKHGAEQLIENAINDPELLKTLVRQPLAASADGGAPAVA
DTGTADDSEIRHE
NT seq 582 nt   +upstreamnt  +downstreamnt
atgacgagcaagtacaaggcttcggccagcggacagaaattcattgcgcgcaaccgcgcg
ccgcgcgtgcagatcgagtacgacgtcgagacttacggcgccgagcgccgcgtccaactg
ccgttcgtgatgggcgtgatcgccgatctcgcgggcaagcgggccgagccgctgccggac
ctgccggagcgcaagttcctcgaagtcgacgtcgacaacttcgacgagcggatgaagtcg
atcgcgccgcgcgtcgcgttccaggtgccgaacacgctgtcgggcgacgggatgctgagc
gtcgacatgacgttcgagagcatcgacgatttctcgcccgccgcgatcgcgcgcaacgtc
gatgcgctgcggcgcctgctggaggcgcgcaccgagctgtcgaacctgctgtcgtacatg
gacggcaagcacggcgccgagcagttgatcgaaaacgcgatcaacgatccggaactgctg
aagaccctcgtgcggcagccgctcgcggcgagcgccgacggcggcgcgccggccgtcgcc
gataccggcaccgcggacgattcggagattcgccatgaatga

DBGET integrated database retrieval system