KEGG   Burkholderia thailandensis E264: BTH_II0262Help
Entry
BTH_II0262        CDS       T00311                                 

Definition
(GenBank) Bacterial protein of unknown function (DUF879) superfamily
  KO
K11896  type VI secretion system protein ImpG
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_II0262
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_II0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ABC35411
UniProt: Q2T8N5
Position
II:320537..322408
Genome map
AA seq 623 aa AA seqDB search
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARV
QLKMDAEFPRFTQALLDAVYPGYVAPVPSMAIMQFTPMMNEGSLAQGYRLPAGTALRARP
AASEQTACEFRTAHDLTLWPLELTAASVTGAPAYLPRSATAARRDVRGALRIRLKACGGA
SLAKLPIERLMFHLAGPERDALHLLELIAGHTIGVVCHDAAQPPRWLHALGADALAHQGF
DAAQALLPDDGRSFQGYRLLREYFAFPARFLFFSIEGLRPALARATGDTFELTLLLDRHD
AALENSVDARHVALNCTPAVNLFARRGDRIPVHPGAREHHVVVDRSRPLDYEVYAVRRLA
GEPRDDAQAREFRPFHASFAGDDGNYGAYYTVRREPRLVSARARANGTRTGYVGSETFVS
LVDSECAPYDESIRYLSADTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAAIRGPSRPR
APIADAQTAWRLVSHLGLARQTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRV
AFTPVFRRLPAAGPLMFGRGVQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAEC
VLSSAQRGRLAQWPARVGRRPAI
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgcctgctcgactactacaaccgcgagctcgcgtacctgcgcgagttgggc
ggcgagttcgcgcagcagtttccgaaagtggccgcgcgcctgcggatgcacgaatcgggg
ccgcccgatccgtacgtcgagcggctgcttgaaggcttcagcttcctcaccgcgcgcgtg
cagctgaagatggatgcggagtttccgcgcttcacgcaggcgctgctcgacgccgtttat
ccgggctacgtcgcgccggttccgtcgatggcgatcatgcagttcacgccgatgatgaac
gaaggcagtctcgcgcaaggctaccggctgccggccggcaccgcgctgcgcgcgcggccg
gccgcgtccgagcagaccgcgtgcgagtttcgcaccgcgcacgatttgacgctgtggccg
ctggaactcacggccgcgtcggtgacgggcgcgcccgcgtacctgccgcgctcggcgacg
gccgcgcggcgcgacgtgcgcggcgcgctgcgcatccgcctgaaggcgtgcggcggcgcg
agcctcgcgaaactgccgatcgagcgcctgatgttccatctcgccggacccgagcgcgac
gcgctgcatctgctcgaactgatcgccgggcatacgatcggcgtcgtgtgccacgacgcg
gcgcagccgccgcgctggctgcacgcgctcggcgcggacgcgctcgcccatcagggcttc
gacgccgcccaggcgctgctgccagacgacggccgcagcttccaaggctatcgcctgctg
cgcgagtatttcgcgtttcccgcgcgcttcctgttcttcagcatcgagggattgcggccc
gcgctcgcgcgcgcgacgggcgacacgttcgagctgacgctgctgctcgaccggcacgac
gcggcgctcgagaacagcgtcgatgcgcggcacgtcgcgttgaactgcacgccggccgtc
aatctgttcgcgcgtcgcggagaccgcattccggtccatccgggcgcgcgcgagcatcat
gtcgtcgtcgatcgcagccggccgctcgactacgaggtctatgcggtgcggcggctcgcg
ggcgagccgcgcgacgacgcccaggcgcgcgagttccggccgttccacgcgtcgttcgcg
ggcgacgacggcaattacggcgcgtactacacggtgcgccgcgagccgcggctcgtatcc
gcgcgcgcgcgcgcgaacggcacgcgcacgggctacgtcggcagcgagacgttcgtgtcg
ctcgtcgacagcgagtgcgcgccgtacgacgaatcgatccgctatctgtccgccgacacg
ctgtgcacgaatcgcgatctcgtgctgctgctgccggcgggcgacgcgaacgcgttcacg
ctgcgcgtgtcggcgcccgtcgagcggatcgccgcgattcgcgggccgtcgcggccgcgc
gcgccgatcgccgatgcgcagaccgcgtggcggctcgtgagccacctcgggctcgcgcgc
caaacgctgaccgacgtcgacgacgaagaaggcgcgcgcgtgctgcgcgaactgctcggc
ctgcatgcggacccggccgacgcggcgatgcgccggcagatcgacggcgtgcatcgcgtc
gcgttcacgccggtgtttcgcaggctgcccgcagccgggccgctgatgttcgggcgcggc
gtgcaggtggatgtgaccgtcgacgatcatgcgttttccggcgacagcccgtatctgctc
ggcgcggtgctcgagcagtttttcgcgcggcacgtgtcgatcaactcgttcgccgaatgc
gtgctgagcagcgcgcagcgcggcaggctcgcgcaatggccggcgcgcgtcggcaggcgg
cccgcgatatga

DBGET integrated database retrieval system