KEGG   Burkholderia thailandensis E264: BTH_II0265Help
Entry
BTH_II0265        CDS       T00311                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bte  Burkholderia thailandensis E264
Pathway
bte03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bte00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BTH_II0265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_II0265
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_II0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C DUF2345
Motif
Other DBs
NCBI-ProteinID: ABC35213
UniProt: Q2T8N2
Position
II:326364..328559
Genome map
AA seq 731 aa AA seqDB search
MFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDES
ERHLNGIVARAALVGRRAQRHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLVTY
GFPIENHLTDTYAPRDYCVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASH
VALPGYEHIPFIARDRTAIADEEHIDSWLPAQEVSIGKHETSDYDYTKPRADLSAQKIDP
RGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHERALARTDVRGIAPGYLFTLEH
CPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQVLVQPSSLPYRSPRATPRPRTN
GPQTATVVGPVGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGVQIP
RIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTTEHSNAF
RFEDKKGAEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNETMSVANDRQRSVGQNET
VNIGKHRVAQIGGNETHGVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIG
QGKTLNVTQHYQTNSKSMKTAVVQHHAEEIGSRTSTIKNAHVLNVGDSQSVNVGASHTMS
VRNNVHVGAGDEIALVCGHASITLKKDGTILINGVTVESSASGSHSVRGKTVTSSATGEH
TVEGTILKLNP
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
gtgttcacactcgacagcctgcacggcgacgacctgaagttccatcgcctctacggcgag
gaagcgctcgggcggatgttcgacttccggatcgaagcgctcgccgacaatcacagcctg
tcgctgaaggaactgctcggcaagccggtgacggtgcgcatccggcagcaggacgaatcg
gagcgccatctgaacgggatcgtcgcgcgcgccgcgctggtcgggcggcgcgcgcagcgg
cattacggctatcaactgatcgtgcggccgtggctgtggctcgcgacgcgccgctccgat
tgccggatcttccagaacaagacggtgccggagatcgtgcaggacgtgctcgtcacgtac
ggctttccgatcgaaaaccatctgaccgacacgtacgcgccgcgcgactactgcgtgcag
tacaacgagaccgacgcggcgttcgtgtcgcggctgatggagttcgaagggatctactac
tacttcaagcacgccgcgcaaacgcacacgctgatgctgtgcgacgcgatggcgtcgcac
gtcgcgctgccgggctacgagcacattccgttcattgcgcgcgaccgcaccgcgatcgcc
gacgaagagcacatcgacagctggctgcccgcgcaggaagtgagcatcggcaagcacgag
acgagcgactacgactacacgaagccgcgcgcggatctgtccgcgcagaagatcgatccg
cgcggccacgaccatgacggcttcgcgtcgttcgaatggcccggcggctatcgcgacgat
gaaccgggcgcgcattacagccgcgtgcggctcgaagagcagcaagcggagcacgaacgc
gcgctcgcgcgcaccgacgtgcgcggcatcgcacccggctatctgttcacgctcgaacac
tgcccgcgcgccgaccagaaccgcgaatacctgatcgtgcgctgccagtatcggtttcag
gagaacgcgtacgcgaccgacagcggaaacgaagcggtcgtgcacgaatcgcaggtgctc
gtgcagccttcgagcctgccgtatcgctcgccgcgcgcaacgccgcggccgcgcacgaac
ggcccgcagacggcgaccgtcgtcggcccggtgggagaagaaatctggacggaccagtac
gggcgcgtgaagctgcaatttcgctgggaccgctacgggcagagcgaccagaactcatcg
tgctgggtgcgcgtgtcgagcccgtgggcgggcggcggcttcggcggcgtgcagatcccg
cgcatcggcgatgaagtggtggtcgattttctgaatggcgatccggatcagccgatcgtg
acggggcgcgtgtacaacggcgagaagatgccgccttgggggttgcccggcagcgcgacg
caaagcgggctgctgtcgcgctcgtcgccgggcggcacgaccgagcattcgaacgcgttt
cgcttcgaggacaagaagggcgcggagcaactgtggatgcacgcggaacgcaacttcgac
gcggaaaccgagcaggaccacacgctgtcggtgggccacgatcactcgcattcggtcggc
aacaacgagacgatgagcgtcgcgaacgaccggcagcggagcgtcgggcagaacgagacg
gtgaacatcgggaaacatcgcgtcgcgcagatcggcgggaacgagacgcatggcgtcgcg
ggcaatcgcacgcggcaggtcggacagaacgaggccgtgacgatcggcgcgaatcgcgag
gcgacgatcggcggcaatcacgtggagacggtcgcgaaagacaagaccgaaacgatcggg
cagggcaagacgctgaacgtcacccagcactaccagacgaattcgaaaagcatgaagacc
gccgtcgtccaacatcacgccgaggagatcggctcgcgaacgtcgacgatcaagaacgcg
cacgtgctcaatgtcggtgattcgcaatcggtgaacgttggcgcaagccatacgatgagt
gtgaggaacaacgtgcatgtcggcgctggcgatgaaatcgcactcgtttgcggccacgcg
agcatcacgctgaagaaggacggcacgatcttgatcaacggcgtcacggtggaatcgagc
gccagcggaagccatagcgtgcgcggcaagacggtgacgtcgtcggcgacgggcgagcac
acggtggaaggcacgatactgaaactgaacccctga

DBGET integrated database retrieval system