KEGG   Burkholderia thailandensis E264: BTH_II0276
Entry
BTH_II0276        CDS       T00311                                 
Name
(GenBank) AMP-binding domain protein
Organism
bte  Burkholderia thailandensis E264
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: ABC35142
UniProt: Q2T8M1
Position
II:complement(340016..341878)
AA seq 620 aa
MTHPPDTTTADAFADFVELMRYRAAHQPDLPVYTFVAGGDRDERHLTCAQLDRRASAVAA
ALSEIARPGERVLLLFAPGIDYIAALFGSMYAGVVAVPAYPVEPAQPERTLRRLLGIVAD
CAPVAVLSTTAVRDDMSRVETGSPVLRGLRWIEIDALAPGDDAAHGAPRAADPRVPVYLQ
YTSGSTGAPKGVMISHQNLLHNSALIARRFEHGASSRGVIWLPPYHDMGLIGGILQPLYV
GFPVTLMSHVDFLKHPLRWLRAIGERRATTSGGPNFAYQMLATMRIADADFDKLDLRSWD
VAFVGAEPIRPATLHAFAQRFARCGFDAHAFYPCYGLAEHTLFMTGGLKSQPPVVAHAPG
DAQQPRASDRADDANDANDADQAGDGRQASARAAIGCGDAASDSLVLIVDPDTRVPCDDG
RVGEIWAQGPSVALGYWNNRALSKQTFEAELPGYEGRFLRTGDYGYRSGSEVFVTGRLKD
MMLIRGANHYPHDVEATIEALDAELFRPGGCAVFALDTGAAPQVTVVRELRARYLKAFGD
GGHEAGHTPDALFGRLRQAINRHHGIAVHHIVFTSPSAIPKTTSGKVQRHACRELFLNDT
LPVITQWRAPCGAPNDIRNI
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgacacatccgcccgatacgacgaccgccgacgcgttcgccgatttcgtcgaactcatg
cgatatcgcgccgcgcatcagcccgatctgcctgtctacacgttcgtcgccggcggcgat
cgcgacgaacggcatctcacatgcgcgcagctggacaggcgtgcaagcgccgtggcggcc
gcgctatcggaaatcgcccggcccggcgagcgcgtgctgctgctgtttgcgcccggcatc
gactatatcgccgcgctgttcggcagcatgtacgcgggcgtcgtggccgtgcccgcgtat
ccggtcgagcccgcgcagcccgagcgcacattgcggcggctgctcggcatcgtcgcggat
tgcgcgcccgtcgcggtgctgtcgacgacggccgtgcgcgacgacatgagccgcgtcgaa
accggttcgcccgtgctgcgcggcctgcgctggatcgagatcgacgcgctcgcgcccggc
gacgatgccgcgcacggcgcgccgcgcgcggccgaccctcgcgtgcccgtctacctgcaa
tacacgtcgggttcgaccggcgcgccgaagggcgtgatgatcagccatcagaacctgctg
cacaactcggcgctgatcgcacgccgcttcgagcatggcgcgagcagccgcggcgtgatc
tggctgccgccgtatcacgacatgggcctgatcggcggcatcctgcagccgctgtacgtc
ggctttccggtgacgctgatgtcgcacgtcgattttctcaagcacccgctgcgctggctg
cgcgcgatcggcgagcggcgcgcgacgacgagcggcgggccgaacttcgcgtatcagatg
ctcgcgacgatgcgcatcgccgacgccgatttcgacaagctcgacctgcgctcgtgggac
gtcgcgttcgtcggcgcggagccgatccggcccgccacgctgcacgcgttcgcgcagcgc
ttcgcgcgctgcggcttcgatgcgcacgcgttctatccgtgctacggcctcgccgagcac
acgctgttcatgacgggcggactgaaatcgcagccgcccgtcgtcgcgcacgcgccgggc
gacgcgcagcagccgcgcgcatccgaccgcgccgacgatgccaacgatgccaacgatgcc
gaccaggccggagacgggcggcaagcaagcgcgcgcgcggcgatcggatgcggcgacgcg
gccagcgacagtttggtgctgatcgtcgatcccgacacgcgcgttccgtgcgatgatggc
cgggtcggcgaaatctgggcgcaagggccgagcgtcgcgctcggttactggaacaatcgc
gcgctcagcaagcagaccttcgaggccgagctgcccggctacgaagggcgattcctgcgc
accggcgattacggctatcggtcgggctccgaagtgttcgtcaccgggcggctgaaggac
atgatgctgattcgcggcgcgaatcattatccgcacgacgtcgaggcgacgatcgaggcg
ctcgacgccgagctgttccgtcccggcggctgcgcggtgttcgcgctcgataccggcgcg
gcgccgcaagtgaccgtcgtgcgcgagctgcgggcgcgctatttgaaggcgttcggcgac
ggcggccacgaagccggccacacgcccgacgcgctgttcggcaggctgcgtcaggcaatc
aaccggcaccacggcattgcggtacaccatatcgtcttcacgtcgccttcggcgataccg
aagacgacgagcggaaaggtccagcggcacgcctgtcgcgaactgtttctcaacgacacg
ctgccggtgatcacccagtggcgcgcgccgtgcggcgcgccgaacgacatccggaacatc
tga

DBGET integrated database retrieval system