KEGG   Burkholderia thailandensis E264: BTH_II0681Help
Entry
BTH_II0681        CDS       T00311                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00260  Glycine, serine and threonine metabolism
bte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01130  Biosynthesis of antibiotics
bte01230  Biosynthesis of amino acids
Module
bte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTH_II0681 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTH_II0681 (trpA)
Enzymes [BR:bte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BTH_II0681 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Peripla_BP_6 His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABC35406
UniProt: Q2T7G9
Position
II:797208..798023
Genome map
AA seq 271 aa AA seqDB search
MSRIQNTFAALAAQGRKGLIPFITAGDPDPSRTVELMHALAEGGADVIELGVPFSDPMAD
GPVIQRSSERALAKGVTLRRVLDDVRRFRERDRQTPVVLMGYANPIERMGEDAFAAAARD
AGVDGVLVVDYPPEESHDFAAKMRAAGIDPIFLLAPTSTDDRIAAVGEVASGYVYYVSLK
GVTGAANLDVSTIEGKIPAIKSRVPLPVGVGFGIRDAATARAVAEVADAVVIGSRLVQLL
EQAAPENAAAELKEFVAGLRAAIDGAAKPAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcagaacacttttgccgcactcgccgcccagggccgcaaggggctgatc
ccgttcatcaccgcgggggacccggacccgtcgaggacggtcgagctgatgcacgcgctt
gccgaaggcggcgccgacgtgatcgagcttggcgtgccgttctccgatccgatggccgac
ggccccgtgatccagcgctcgtcggagcgcgcgctcgcgaaaggcgtgacgcttcgccgc
gtgctcgacgacgtgaggcgctttcgcgagcgcgaccggcagacgcccgtcgtgctgatg
ggctacgcgaatccgatcgagcggatgggcgaggacgcgtttgcggcggccgcgcgcgac
gcgggcgtcgacggcgtgctcgtcgtcgactatccgcccgaggagtcgcacgatttcgcc
gcgaagatgcgcgcggcgggcatcgatccgatcttcctgctcgcgccgacgtcgaccgac
gaccggatcgccgccgtcggcgaggtggcgagcggttacgtctactatgtgtcgctcaag
ggcgtgacgggcgccgcaaatctggatgtttccaccattgagggtaaaatcccggccatc
aagtcgcgcgtgccgcttcccgtcggggtgggtttcggcatccgcgacgccgcgacggcg
cgcgcggtggccgaggtggcggatgccgtcgtgatcggcagccgcctcgtccagttgctg
gagcaggccgcgccggagaacgccgccgccgagctcaaggagttcgtcgccgggttgcgc
gccgcgatcgacggcgcggcgaagccggcggcgtga

DBGET integrated database retrieval system