KEGG   Burkholderia thailandensis E264: BTH_II0856
Entry
BTH_II0856        CDS       T00311                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bte  Burkholderia thailandensis E264
Pathway
bte03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bte00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BTH_II0856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_II0856
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_II0856
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ABC34611
UniProt: Q2T6Z6
Position
II:complement(1001572..1002252)
AA seq 226 aa
MMKLSDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDQAACAGAPEADVDDALFA
VCAWIDEALLNSGWNDAERWTLRLLQKRYFDTSHAGVVFFERLDALDGARADVLDVYLLC
LQLGFRGRYGYDGGSGPLDAIRQRALDALSAHAPPCAAHALPFPAAYPHAETQPGAHAIA
AKARARRRIALAGRNFGLPLAILLSLYLIYHAVIVRMVDSVFPRLQ
NT seq 681 nt   +upstreamnt  +downstreamnt
atgatgaagctgtccgattcgatgatgccgctcgtcgcctatgcgcggcagctcgcgcaa
tcgccgcgcggcgacgccgccgaagtcgcgctgcggctcgacatcctgatcgagcgcgcg
cgcgaccaggcggcgtgcgccggcgcgcccgaagccgacgtcgacgacgcgctgttcgcg
gtgtgcgcgtggatcgacgaggcgctgctgaacagcggctggaacgacgccgagcgctgg
acgctgaggctgctgcaaaagcgttacttcgatacatcgcacgcgggcgtcgtgttcttc
gagcgcctcgacgcgctcgacggcgcgcgcgcggacgtgctcgacgtctatctgctgtgc
ctgcagctcggctttcgcggccgctacggctacgacggcggcagcgggccgctcgacgcg
atccggcagcgcgcgctcgacgcgctgtcggcgcacgcgccgccgtgcgccgcgcacgcg
ctgccgtttcccgccgcgtatccgcacgccgagacccagcccggcgcgcacgccatcgcg
gcgaaggcgcgcgcgcgccgccgcatcgcgctcgccggacggaacttcgggctgccgctc
gcgatcctgctgtcgctttatctgatctatcacgccgtcatcgtgcggatggtcgactcg
gtattcccgaggctgcaatga

DBGET integrated database retrieval system