KEGG   Burkholderia thailandensis E264: BTH_II0858Help
Entry
BTH_II0858        CDS       T00311                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bte  Burkholderia thailandensis E264
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN Bacillus_PapR
Motif
Other DBs
NCBI-ProteinID: ABC35122
UniProt: Q2T6Z4
Position
II:complement(1003676..1004482)
Genome map
AA seq 268 aa AA seqDB search
MSDRRIFMPAAAQARRPTQPAQACRSSRQLRPRRACAARACAATLAALAALAGCAAGVTE
EQARADVRWDYAPDALRIDIDASPRLNEYLNAPHTLLLAVFQSADARTFRQLADDPDRLR
MTLAAGGPATDFIQTTRYVVEPGARVALSIDRAQQARYVGIVAGYYDADSPRAARLFDVP
LRIDKRGWFSSTYRAAPRTLGLKLRLGAQSITDAREAPLNLPPPGARAWTTLDGGAKTLT
LPAGDANGSENGGGGDENDASAHAPRKR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgacggattttcatgccggcggcagcgcaagcgcgccggccgacgcaaccg
gcgcaagcttgccgatcatcacggcagttgcggccacgccgcgcatgcgcggcgcgcgcg
tgcgcggccacgctcgccgcgctggccgcgctggccggctgcgcggccggcgtcaccgag
gagcaggcgcgcgccgacgtgcgatgggactacgcgcccgacgcgctgcgcatcgacatc
gacgcgtcgccacggctcaacgaatacctgaacgcgccgcacacgttgctgctcgcggtg
ttccaaagcgcggacgcgcggacgttccgccagctcgccgacgatccggaccggctgcgc
atgacgctcgcggcgggcggccccgcgacggacttcatccagacgacgcgctacgtggtc
gagccgggcgcgcgcgtcgcgctgtcgatcgatcgtgcgcagcaggcgcgctacgtcggc
atcgtcgccggctactacgacgccgacagcccgcgcgccgcgcgcctcttcgacgtgccg
ctgcgaatcgacaagcgcggctggttctcgtccacctaccgcgccgcgccgcgaacgctc
gggctgaagctgcggctcggcgcgcagagcatcaccgacgcgcgcgaagccccgctgaac
ctgccgccgccgggcgcgcgcgcgtggacgacgctcgacggcggcgcgaaaacgctgacg
ctgccggccggcgacgcgaacggaagcgaaaacggcggcggcggcgacgaaaacgacgcc
tccgcccacgcgccgcgcaagcgatga

DBGET integrated database retrieval system