KEGG   Burkholderia thailandensis E264: BTH_II0865Help
Entry
BTH_II0865        CDS       T00311                                 

Definition
(GenBank) Protein of unknown function (DUF1305) superfamily
  KO
K11895  type VI secretion system protein ImpH
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bte02044]
    BTH_II0865
Secretion system [BR:bte02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTH_II0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: ABC35006
UniProt: Q2T6Y7
Position
II:complement(1015352..1016407)
Genome map
AA seq 351 aa AA seqDB search
MAAADGGAMPALEPVLLGEAKHFAYFQAIRLLRRIVRERREHHAGAASAPAAPMPIHTRP
NLALSFPDTDVERIDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFKGRHAARGF
LDVLHRALYPLLFDAWLKHRLSLRIVEERDAHALRPLYALAGVDARIARDAGLPEHALLR
HVGLLSQRPRSASGLRALLADAFAPAAVDIEPCVPQWLPIPDDQRTRVGARAHRLGVDAR
VGARMRDDGARLRIVLRDVPGPLFRALMPGGDAFRRLRFLVRLYLTQPFTVDVAIRVRAR
DALPARCGGGAWSRVGLDAWLGGPPAERAAAPQFRLPTSLFDQARPHHAAG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcggatgggggcgcaatgcctgctctagaaccggtgctgctcggcgaggcc
aagcacttcgcgtattttcaggcgatcaggctgctgcggcgcattgtccgcgaacggcgc
gagcatcacgcaggcgcggcgagcgcgcccgccgcgccgatgccgatccacacgcggccg
aatctcgcgctgtcgttcccggacaccgacgtcgagcgcatcgataaggcggacgacggc
ggctaccgcgtcgtcgcgaacttcttcgggctgtacggcgtgtcgtcgccgctgccgacg
ttctataccgaagacctgatcgacgaagcgttcaaaggccgtcacgcggcgcgcggcttt
ctcgacgtgctgcatcgcgcgctctatccgctgctgttcgacgcgtggctcaagcatcgg
ctgtcgctgcgcatcgtcgaggagcgcgacgcgcacgcgctgcgcccgctctacgcgctc
gcgggcgtcgatgcgcgcatcgcgcgcgacgcgggcctgcccgagcacgcgctgctgcgc
catgtcgggctgctgagccagcggccgcgctcggcgtccggattgcgcgcgctgctcgcc
gacgcgttcgcgcccgcggcggtcgacatcgagccgtgcgtgccgcagtggctgccgatt
cccgacgatcagcgcacccgcgtcggcgcgcgcgcgcatcggctcggcgtcgacgcgcgc
gtcggcgcacgcatgcgcgacgacggcgcccggctgcggatcgtgctgcgcgacgtgccc
ggcccgctgtttcgcgcgctgatgccgggcggcgacgcgttccgacggctgcggtttctc
gtgcgcctctatctgacgcagccgttcacggtcgacgtcgccatccgcgtgcgcgcgcgc
gacgcgctccccgcgcgctgcggcggcggcgcgtggtctcgcgtcgggctcgacgcgtgg
ctgggcgggccgcccgccgaacgcgcggcagcgccccaattccgtcttccgacctccctc
tttgatcaagcgagaccccatcatgctgctggttga

DBGET integrated database retrieval system