KEGG   Burkholderia thailandensis E264: BTH_II0930Help
Entry
BTH_II0930        CDS       T00311                                 

Definition
(GenBank) probable pyruvate dehydrogenase, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00010  Glycolysis / Gluconeogenesis
bte00020  Citrate cycle (TCA cycle)
bte00620  Pyruvate metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
Module
bte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II0930
   00020 Citrate cycle (TCA cycle)
    BTH_II0930
   00620 Pyruvate metabolism
    BTH_II0930
Enzymes [BR:bte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BTH_II0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C Peptidase_M23 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ABC33943
UniProt: Q2T6S2
Position
II:1092822..1093961
Genome map
AA seq 379 aa AA seqDB search
MIEFTLPSMGADMDEGTLLEWKVKPGDAVKKGQVVAVVDTSKAAVDIESWQEGTVDELIV
EPGEKIPVGTPIATLLEPGETPPAVRPVRRRARPAAAVGAGARRKISPAARQRAMRGGVD
LDAVSGTGPGGSVTLADVERTSAAAAAPSEAAATGDRAREMRRVIAAAMARSKHEIPHYY
VSEPIPLGKALAWLAAENAKRSVVDRLLPAALLLKAVAVTLTRFPELNGFYRQGAFQPAG
QVHLGVAISLRQGGLIAPALLDAGTKPLTQLMRELADLTQRSRAGSLRSAELSQSTITVT
NLGDRGAAEVFGIIYPPQVALVGFGRIVERPWAEGGALGVMPVVTASVSADHRVSDGHRG
ALFLVELSEALQNPEALSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaattcacgttgccttcgatgggcgccgacatggacgaggggacgctcctcgaa
tggaaggtcaagcccggggacgccgtgaagaagggccaggtggtggccgtcgtcgatacg
agcaaggccgccgtcgatatcgaaagctggcaggagggcacggtcgacgaactgatcgtc
gagccgggcgagaagattccggtgggcacgccgatcgcgacgctgctcgaacccggcgaa
acgccgcccgccgtcaggcccgtgcgccggcgggcgaggccggccgcggccgtcggcgcg
ggcgcgcggcgcaagatttcgccggccgcccggcagcgggcgatgcgaggcggcgtcgat
ctcgacgcggtgtcgggcaccggccccggcggctcggtgacgttggcggatgtcgagcgg
acatcggccgccgccgcggctccgagcgaggctgccgcgacgggcgaccgcgcgcgcgaa
atgaggcgcgtgatcgccgccgcgatggcgcgctcgaagcacgagatcccgcactactac
gtgtccgaaccgattccgctgggcaaggcgctcgcatggcttgcggcggagaacgcaaag
cgttccgtcgtcgaccggctgctgccggccgcgctgttgctcaaggccgtggccgtgacg
ctgacccggtttccggagctcaacggcttctatcgtcaaggggcctttcagcctgccggc
caggtgcacctcggcgtggcgatctcgctgcgccagggcggcctgatcgcgcccgcgctg
ctcgatgcgggcacgaagccgctgacccaattgatgcgcgaactcgcggacctgacgcaa
cgtagccgcgccggctcgttgcgcagcgccgagctgtcgcaatcgacgatcaccgtgacg
aatctcggcgatcgcggcgccgcggaggtgttcggcatcatctatccgccgcaggtcgcg
ctcgtggggttcgggcgaatcgtcgagcggccgtgggccgaaggcggggcgctcggggtc
atgccggtcgtgaccgccagcgttagcgccgaccatcgcgtctccgacggccatcgcggc
gcgttgttcctcgtcgagctgagcgaagcgttgcagaacccggaggcattgagcagatga

DBGET integrated database retrieval system