KEGG   Burkholderia thailandensis E264: BTH_II1410Help
Entry
BTH_II1410        CDS       T00311                                 

Definition
(GenBank) histidine ABC transporter, permease protein
  KO
K10016  histidine transport system permease protein
Organism
bte  Burkholderia thailandensis E264
Pathway
bte02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bte00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTH_II1410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bte02000]
    BTH_II1410
Transporters [BR:bte02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BTH_II1410
   Histidine transporter
    BTH_II1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABC35188
UniProt: Q2T5E3
Position
II:complement(1661718..1662407)
Genome map
AA seq 229 aa AA seqDB search
MLFQGFGPLLWAGTIETVKLAVLSLAASLVLGLAGAAAKLSSNRALASVGTFYTTLIRAV
PDLVLMLLLFYGIQILLNNATDMLGIDQIDIDPFVAGVLTLGFIYGAYFTETFRGAFLAV
PRGQLEAGFAYGMGSWRVFARIMFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
SQDAGKSTLNFFFFTLAAGAIYLAITTLSNVVLMYLEKRYSAGVRRLAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctctttcaaggcttcggcccgctgctgtgggccggcacgatcgagacggtcaagctc
gccgtgctttcgcttgccgcgtcgcttgtgctcgggctcgccggcgcggccgccaagctg
tcgtccaatcgcgcgttggcgagcgtcggcacgttctacacgacgctgattcgcgcggtg
ccggatctcgtgctgatgctgctgctgttctatggcatccagatcctgctgaacaacgcg
accgacatgctcggcatcgatcagatcgacatcgacccgttcgtcgccggcgtgctgacg
ctcggcttcatctacggcgcgtacttcaccgagacgtttcgcggcgcgttcctcgcggtg
ccgcgcgggcagctcgaagcgggcttcgcgtacggcatgggttcgtggcgcgtcttcgcg
cggatcatgtttccgcagatgatgcgctttgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaggcgacggcgctcgtgtcgatcatcggcttggccgacgtcgtgaaggcg
tcgcaggacgcgggcaagagcacgctgaacttctttttcttcacgctcgcggcgggcgcg
atctatctcgcgatcacgacgctgtcgaacgtcgtgctgatgtacctcgaaaaacgctat
tcggcgggtgtgcggaggctggcgctgtga

DBGET integrated database retrieval system