KEGG   Burkholderia thailandensis E264: BTH_II1870Help
Entry
BTH_II1870        CDS       T00311                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00625  Chloroalkane and chloroalkene degradation
bte00680  Methane metabolism
bte01100  Metabolic pathways
bte01120  Microbial metabolism in diverse environments
bte01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BTH_II1870
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTH_II1870
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BTH_II1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ABC35936
UniProt: Q2T435
Position
II:complement(2265414..2266847)
Genome map
AA seq 477 aa AA seqDB search
MRVARIAAVADCAYGADGASARPFPSHVGRGQADVGFWTLAPLARGLPSEGSLQVRPMRV
RAGRATRGAPPTRHGDEAMSSNRGVVYQGPGKVEVQKIDYPKMVDPSGRAIGHGVILKVV
STNICGSDQHMVRGRTTAPVGLVLGHEITGEVVEVGRDVETLRIGDLVSVPFNVACGRCA
MCKEQHTGVCLNVNPSRAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMTKI
RDLTCLSDILPTGYHGAVTAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAE
RLAHAKAMGFEVVDLSKDATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAEEAPAT
VLNSLMEITRPAGAIGIPGLYVTDDPGAADAAAKHGSLSIRFGLGWAKSHSFHTGQTPVL
KYSRNLMQAILFDRLPIAQIVNVTVISLDDAPEGYRKFDGGAPRKFVIDPHGMLKAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgtcgcgcggatcgccgctgtcgccgattgtgcctatggtgccgatggcgcgtcg
gcgcggccgtttccatcgcatgtcggtcgcggccaagccgatgtcggtttttggacgctc
gcccccctggctcgcggactaccctcggaaggctcgctgcaagtcaggccgatgcgcgta
cgcgcgggccgggcgacgcgcggcgcaccgccaacgagacatggagacgaagcgatgagc
agcaaccgaggtgtcgtgtatcaggggccgggcaaggtcgaggtgcagaagatcgactat
ccgaagatggttgatccgagcggccgcgcgatcggccacggcgtgatcctgaaggtcgtc
agcacgaatatctgcggctccgatcagcacatggtgcgcggccgcacgacggcgcctgtc
ggtctcgtgctcggccacgagattacgggcgaggtggtcgaggtgggccgcgacgtcgag
acgctgaggatcggcgatctggtgtcggtgccgttcaacgtcgcgtgcggccgctgcgcg
atgtgcaaggagcagcacacgggcgtgtgcctgaacgtgaatccgtcgcgcgcgggcggc
gcgtacggctacgtcgacatgggcggctggatcggcggtcaggccgaatacgtgctcgtg
ccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatgacgaagatc
cgcgatctcacgtgtctgtcggacatcttgccgaccggctatcacggcgcggtcacggcc
ggcgtgaagcccggctcgacggtctacgtcgcgggcgcgggcccggtcgggatggcggcc
gccgcgtcggcgcgcctgctcggcgccgcgtgcacgatcgtcggcgacatgaacgccgaa
cgtctcgcgcacgcgaaggcgatgggcttcgaagttgtcgatctgtcgaaggacgcgacg
ctcggcgagcagatcgagcagattctgggcaagccggagatcgattgcgcagtcgactgc
gtcggcttcgaggcgcacgggcacggttcgtccggtcacgcggaggaggcgcccgcaacg
gtgctgaactcgctgatggagatcacgcggcccgcgggcgcgatcggcattcccggcctg
tacgtgaccgacgatccgggcgccgccgacgccgccgcgaagcacggcagcctgagcatc
cgcttcggcctcggttgggcgaagtcgcactcgttccataccggccagacgcccgtgctc
aagtacagccgcaatctgatgcaagcgatcctgttcgaccggctgccgatcgcgcagatc
gtcaacgtgacggtgatttcgctcgacgatgcgccggaaggctacaggaagttcgacggc
ggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system