KEGG   Burkholderia thailandensis E264: BTH_II1941Help
Entry
BTH_II1941        CDS       T00311                                 

Definition
(GenBank) agmatinase, putative
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00330  Arginine and proline metabolism
bte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BTH_II1941
Enzymes [BR:bte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BTH_II1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABC35193
UniProt: Q2T3W4
Structure
PDB: 

Position
II:complement(2363388..2364350)
Genome map
AA seq 320 aa AA seqDB search
MNETLYGDGAIRRPSVYGSSIENTYAGVLSFMRRNYTRDLDGVDVVVSGVPLDLATTFRS
GARLGPSAVRAASVQLAELNPYPWGFDPFDDLAVIDYGDCWFDAHHPLSIKPAIVEHART
ILQSDARMLTLGGDHYITYPLLIAHAQKYGKPLSLIHFDAHCDTWADDAPDSLNHGTMFY
KAVKDGLIDPKASVQVGIRTWNDDYLGINVLDAAWVHEHGARATLERIESIVGGRPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIA
AAHVACDLLCLWRQRKAGAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacgctttatggcgacggcgcgatccgccgtccatccgtctacggttcctcg
atcgaaaacacttacgcgggcgtgctgtcgttcatgcggcgcaactacacgcgcgatctc
gacggcgtcgacgtcgtcgtgtccggcgtgccgctcgatctcgcgacgacgtttcgctcc
ggcgcgcgcctgggcccgtccgcggtgcgcgcggcgagcgtgcagcttgccgagctgaat
ccgtatccctggggattcgatccgttcgacgatctcgcggtgatcgactacggcgactgc
tggttcgacgcgcaccatccgctctcgatcaagcccgcgatcgtcgagcacgcgcggacg
atcctgcaatcggacgcgaggatgctgacgctcggcggcgaccactacatcacgtatccg
ttgctgatcgcgcatgcgcagaagtacggcaagccgctgtcgctgatccatttcgacgcg
cactgcgacacgtgggccgacgacgcgcccgacagcctcaatcacggcacgatgttctac
aaggccgtcaaagacgggctgatcgatccgaaggcgtcggtgcaggtcggcatccgcact
tggaacgacgactatctcggcatcaacgtgctcgacgccgcctgggtgcacgagcacggc
gcgcgcgcgacgctcgagcgcatcgagtcgatcgtcggcggccggcctgcctatctgacg
ttcgacatcgactgcctcgatcccgcgttcgcgccgggaacgggcacgccggtcgcgggc
gggctgtcgtccgcgcaggcgctcgcgatcgtgcgcggtctcggcggcgtgaacctgatc
ggcgcggacgtcgttgaggtcgcgcccgcttacgaccagagcgagatcaccgcgatcgcg
gccgcgcatgtcgcatgcgatctgctgtgtctgtggcggcagcgcaaggcgggcgcgcgc
tga

DBGET integrated database retrieval system