KEGG   Burkholderia thailandensis E264: BTH_II2004Help
Entry
BTH_II2004        CDS       T00311                                 

Definition
(GenBank) Adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00230  Purine metabolism
bte00250  Alanine, aspartate and glutamate metabolism
bte01100  Metabolic pathways
Module
bte_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BTH_II2004
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTH_II2004
Enzymes [BR:bte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BTH_II2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt AAA_18 AAA_33 AAA_22 T2SSE
Motif
Other DBs
NCBI-ProteinID: ABC33958
UniProt: Q2T3Q1
Position
II:complement(2450618..2452303)
Genome map
AA seq 561 aa AA seqDB search
MSNRQIVVISGKACSGKTGLADLLEQEFQFRVVRTRQVLVDFCDAEIDENELVTLITRKQ
EVNETTDSRWLLRATLEVLEGLDPAKSVVVDHVSSPLQVAQFRRVFGENLIHVHLYASKE
TLQERYAQTEAAKKNVLSYDEIDRLKDEKDIEALKNDADVRIYTTRSDAQDTLVRVAARL
HLFTPPDIRCVDVLIGGQYGSEGKGNVVSYLAREYDVMVRVGGPNAGHTVASANGPYTYH
HLPSGARDVDSRLLLGPGMTIRLKGLFEEICDCNIGPDRLFIDPQATIIEDKDIESEGQH
LVSTIASTGSGSGAATARRIISRGSSDFRMARDVPALAPYVGTPGNYHGATADRLEEAYR
KRQSILLEGTQGSGLSLFHGTYPYVTSRDTNVAGCLAEAGISPSRVRKILMVIRPMPIRV
GDPDGNEGHTSGPLKHPTTFDAIARHADLDAAALHSAEKTSTTKRKRRVGWFEWDQFRRA
CALNAPTDIVLTFADYINASNRNARRFEQLTQETIKFVEELERVSQAPVSLINTRFPRQE
EGIDDLRSLIDRRNWTARSRA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgtcagattgtcgtcattagcggaaaggcctgtagcggtaagaccggactt
gccgatctacttgaacaggagtttcagttccgcgttgtccgtaccaggcaggtattggtt
gacttttgcgatgccgaaatcgatgaaaacgagctggtaactttgataacgcggaagcag
gaagtaaatgaaaccaccgattcgaggtggctgctacgtgccacgcttgaggtattagaa
ggtctggacccggctaaatcagtggtcgtagaccatgtcagtagccctttgcaagtagct
caatttcggcgagtattcggtgaaaatctcattcacgttcacctatacgcaagtaaggaa
acgttgcaggagcggtacgcccaaacggaggcggcaaagaagaatgtcctctcatatgat
gaaatagaccgcttaaaagatgagaaggacattgaagcgcttaagaacgatgccgatgtc
cgtatctacactactcgttccgatgcccaagacactttggttcgagttgccgcccgcttg
cacttgtttaccccgcctgatattcgatgcgtcgacgtgttgatcggcggtcagtatggc
agcgagggcaaggggaacgttgtttcgtacctcgctcgcgaatatgacgtaatggtgcgg
gttggggggccaaatgcaggacatactgtagccagcgcgaacggaccctatacatatcat
catctgccctccggggctcgcgacgtggattctcgcttgcttcttggtccggggatgacc
attcgtctcaaaggtctattcgaggaaatttgcgactgcaacattggaccggaccgattg
tttatcgatccacaggcgacaattattgaagacaaggatatcgagagtgaaggccaacat
ctcgtctcgactatcgcgtcgactggcagcggcagcggtgctgctacagctcggcgtatc
atcagtcgtggcagttcagactttcgtatggctcgcgacgtccccgcactcgcgccttat
gtcggtacgccgggaaattaccacggcgctaccgccgatcgcttggaagaagcctaccgg
aaacggcaatccatcctactcgaaggcacccaaggtagtgggctaagtctctttcacggc
acatacccatatgtgacctcgcgcgataccaacgttgctggttgcctcgcggaggccggc
atctcaccgagccgcgtgcgcaaaattctaatggtgatccgcccgatgcccattcgggtg
ggtgacccggatggcaatgaagggcacacttcgggtccactcaaacatccgacgacgttc
gatgccattgcgagacacgcggatcttgatgccgctgcgttgcatagtgccgaaaagact
tcgacgaccaaacgaaagcgtcgtgtcggttggtttgaatgggaccaatttcgcagggcc
tgtgcccttaatgcgccgacagatattgttctgacgtttgcggactatatcaacgccagc
aaccgaaatgcgcgtcgttttgaacaattgacgcaagaaaccatcaagtttgttgaggag
cttgaacgcgtttcgcaggcgccggtttcgcttataaatacccgctttccgcgccaggaa
gagggtatagacgatttacgctcactaatcgaccgtcgcaattggacagctcgctcccgt
gcttga

DBGET integrated database retrieval system