KEGG   Burkholderia thailandensis E264: BTH_II2017Help
Entry
BTH_II2017        CDS       T00311                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00010  Glycolysis / Gluconeogenesis
bte00620  Pyruvate metabolism
bte00640  Propanoate metabolism
bte00680  Methane metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II2017 (acsA)
   00620 Pyruvate metabolism
    BTH_II2017 (acsA)
   00640 Propanoate metabolism
    BTH_II2017 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BTH_II2017 (acsA)
Enzymes [BR:bte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BTH_II2017 (acsA)
Lipid biosynthesis proteins [BR:bte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BTH_II2017 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABC35414
UniProt: Q2T3N9
Position
II:complement(2464642..2466624)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEGFWARLARETLEWRKP
FGKALDETNAPFYKWFDDGELNASYNCLDRHVAAGLGERIAVIFEADDGTVARVTYADLL
ARVSRFANALKKRGIGRGDRVVIYIPMSVEGIVAMQACARIGATHSVVFGGFSSKSLHER
IVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKTVVVYRRTGGNVDWHAGRD
VWMHEIVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFD
WKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVSVF
YTAPTAIRSLIKAAEADEHVHPKSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQERCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMARTIWGDPERFKKSYFPDELGGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLAEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttctgcacgaacgccgccagttcgcgccgcccgccgccgtg
gagaaggcggcagccatttccggcatggcggcttatcgggcgctcgccgaagaggctgag
cgcgattacgaaggattctgggcgcgtctcgcgcgtgagacgctcgaatggcgcaagccg
ttcggcaaggcgctcgacgagacgaacgcgccgttctacaagtggttcgacgacggcgag
ttgaacgcgtcgtacaactgcctcgaccgccacgtcgccgccggcctcggcgagcgcatc
gcggtgatcttcgaggccgacgacggcaccgtcgcgcgcgtgacctacgccgatctgctc
gcgcgcgtgtcgcgcttcgcgaacgcgctgaagaaacgcggcatcggccgcggcgaccgc
gtcgtcatctacattccgatgtcggtcgaaggcatcgtcgcgatgcaggcgtgcgcgcgc
atcggcgcgacgcattcggtcgtgttcggcggcttttcgtcgaagtcgctgcacgagcgc
atcgtcgacgtcggcgcgaccgcgctcgtcacggccgacgagcagatgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaggcgctcgcgatgggcggctgcgacgcggtg
aagaccgtcgtcgtctatcggcgcacgggcggcaacgtcgactggcacgcgggccgcgac
gtctggatgcacgagatcgtcgcgaacgagtccgacgcgtgcgagcccgagtgggtcggc
gccgaacatccgctgttcatcctgtatacgtcgggctcgaccggcaagccgaagggcgtc
cagcacagcacggccggctatctgctgtgggtcgcgcagacgatgaagtggacgttcgac
tggaagcctgacgacgtgttctggtgcacggccgacatcggctgggtcacggggcactcg
tacatcacgtacgggccgctcgccgtcggcgcgacgcaggtcgtgttcgagggcgtgccg
acctatccgaacgcgggccgcttctggaagatgatcggcgaccacaaggtttccgtgttc
tacaccgcgccgacggcgatccgctcgctgatcaaggcggccgaggccgacgagcacgtg
catccgaagagctacgatctgtcgagcctgcggatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatctggtatcacaagaacgtcgggcaggagcgctgcccgatcgtc
gacacgtggtggcagaccgaaacgggcggccacatgatcacgccgctgccgggcgcgacg
ccgacggtgccgggctcgtgcacgttgccgctgccgggcatcatggccgccgtcgtcgac
gagaccggccaggacgtgccgaacgggcagggcggcattctcgtcgtcaagcgtccgtgg
ccggcgatggcgcgcacgatctggggcgacccggagcgcttcaagaagagctatttcccc
gacgagctcggcggccgcctctatctggcgggcgacggcaccgtgcgggacaaggaaacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtatcggggcaccggctc
ggcacgatggagatcgaatcggcgctcgtgtcgcacgagctcgtcgcggaggcggccgtc
gtcggacggccggacgacacgacgggcgaggcggtcgtcgcgttcgtcgtgttgaagcgc
tcgcggccggaaggcgaagaggcggccgcgctcgcgaagacgctgcgcgactgggtcggc
aaggaaatcgggccgatcgcgaagccgaaggacatccgtttcggcgacaacctgccgaag
acgcgttcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtcgacgctcgagaaccccgcgatcctcgagcagctcgccgaagtgcgc
tga

DBGET integrated database retrieval system