KEGG   Burkholderia thailandensis E264: BTH_II2022Help
Entry
BTH_II2022        CDS       T00311                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00471  D-Glutamine and D-glutamate metabolism
bte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BTH_II2022 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bte01011]
    BTH_II2022 (murI)
Enzymes [BR:bte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BTH_II2022 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bte01011]
 Precursor biosynthesis
  Racemase
   BTH_II2022 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABC34354
UniProt: Q2T3N4
Position
II:2470905..2471771
Genome map
AA seq 288 aa AA seqDB search
MTPHAPDSRVSPARSPIGIFDSGLGGLSVLRAVRERLPDEAIVYVADSRHAPYGPRDDAF
IIERTLAIGEWLVAQGAKALVVACNTATAQSIAVVRERLPIPLVGVEPGIKPAALHSKTR
VAGVLATQATLRSARFEALIARHAADCRFICQAGHGLVEAIERGDTGSPELRAQLAGFLE
PMLEAGADTLVLGCTHYPFLDAAIRDVTSSRLHLIDTSDAIARQLARILDERGLRAPASS
RPAPPRLCSTGDGRHLQTLAATLLGLDVAVESVTISSPSTAAPAADPA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgcacgcgcccgattcccgcgtatcgcccgcccgctcgccgatcggcatcttc
gattcggggctcggcggcctgtccgtgctgcgcgcggtgcgcgagcggctgcccgacgag
gcgatcgtctacgtcgccgattcgcgccatgcgccatacgggccgcgcgacgacgcgttc
atcatcgagcgcacgctcgcgatcggcgaatggctcgtcgcgcagggcgcgaaggcgctc
gtcgtcgcatgcaacaccgcgaccgcgcagtcgatcgcggtcgtgcgcgaacgtctgccg
atcccgctcgtcggcgtcgagcccggcatcaagccggcggcgctgcattcgaagacgcgc
gtcgccggcgtgctcgcgacgcaagcgacgctgcgcagcgcgcgcttcgaagcgctgatc
gcgcgccatgcagccgattgccgcttcatttgccaggcggggcacggcctcgtcgaggca
atcgagcgcggcgacaccggctcgcccgagttgcgcgcgcagctcgcgggcttcctcgag
ccgatgctcgaagcaggcgccgatacgctcgtgctcggctgcacgcactacccgttcctc
gacgccgcgatccgcgacgtgacgtcgagccgcctgcatctgatcgacacaagcgacgcg
atcgcccgccaactcgcacgcatcctggacgagcgtgggctgcgcgcgcccgcctcgtcc
cggccggcgccgccgcgcctctgctcgacgggcgacgggcggcatttgcaaacccttgcc
gcgacactgctcggcctcgacgtggcggtcgaatccgtcaccatttcctctcccagcacg
gccgcgccggccgccgatccggcgtag

DBGET integrated database retrieval system