KEGG   Burkholderia territorii: WS51_02150Help
Entry
WS51_02150        CDS       T04843                                 

Definition
(GenBank) histidine ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
btei  Burkholderia territorii
Pathway
btei02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WS51_02150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btei02000]
    WS51_02150
Transporters [BR:btei02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    WS51_02150
   Histidine transporter
    WS51_02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1440
Motif
Other DBs
NCBI-ProteinID: AOI62475
UniProt: A0A104ALS5
Position
2:455709..456398
Genome map
AA seq 229 aa AA seqDB search
MIFQGFGPLLWAGTVETVKLAVLSLAASLILGLAGAGAKLSANRVLKSVGTFYTTLIRAV
PDLVLMLLLFYGIQILLNNATDLLGWDQIDIDPFVAGVVTLGFIYGAYFTETFRGAFLAV
PRGQLEAGFAYGMSGWRVFHRILFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
SQDAGKSTLDFFFFTLAAGAIYLAITTVSNVVLHHLEKRYSAGVRRLAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatcttccaaggatttggcccgctgttgtgggccggcacggtcgagaccgtgaagctc
gcggtgctgtcgctcgccgcgtcgctgatactgggcctcgcgggcgcgggcgcgaaactg
tcggcgaaccgcgtgctcaagtcggtcggcacgttctacacgacgctgatccgcgcggtg
cccgatctcgtgctgatgctgttgctgttctacgggatccagatcctgctgaacaatgcg
accgacctgctcggctgggatcagatcgacatcgacccgttcgtggccggcgtcgtgacg
ctcggcttcatctacggcgcgtacttcaccgaaacgttccgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaagcgggcttcgcatacgggatgagcggctggcgcgtgttccac
cggatcctgttcccgcagatgatgcgcttcgcgctgccgggcatcggcaacaactggcag
gtgctcgtgaaggccaccgcgctcgtgtcgatcatcggcttggccgatgtcgtgaaggcg
tcgcaggacgccggcaagagcacgctcgatttcttcttcttcacgctcgcggccggtgcg
atctacctcgcgatcacgacggtgtcgaacgtcgtgctgcaccacctcgagaagcgttat
tccgccggcgtccggaggcttgcactgtga

DBGET integrated database retrieval system