KEGG   Burkholderia territorii: WS51_09780Help
Entry
WS51_09780        CDS       T04843                                 

Definition
(GenBank) amidohydrolase
  KO
K01451  hippurate hydrolase [EC:3.5.1.32]
Organism
btei  Burkholderia territorii
Pathway
btei00360  Phenylalanine metabolism
btei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    WS51_09780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:btei01002]
    WS51_09780
Enzymes [BR:btei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     WS51_09780
Peptidases and inhibitors [BR:btei01002]
 Metallo peptidases
  Family M20
   WS51_09780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AOI63814
UniProt: A0A125GG89
Position
2:complement(2232299..2233489)
Genome map
AA seq 396 aa AA seqDB search
MTTDVRFTEIEDLMPAAGGLREIRHHIHHHPELAYEEHDTAALVADKLEQWGWQVTRGVG
KTGVVGTLRVGDGTRSIGIRADMDALPIVEATGLPYASGTPGKMHACGHDGHTTMLLGAA
QHLAKTRNFSGTVHLYFQPAEEHGVDSGAKKMIDDGLFERFPCDAVFGMHNHPGAAPGVF
LTRRGPFMSAGDKAIISIEGVGGHAARPHLTVDPVVVAASIVMALQTIVARNVDPSQPAV
VTVGSMHAGTANNVIPNGARLELSVRSFSPDVRALLKRRIVELAESQAASYGATAHVEYI
EGYPVVVNTDAETDFAAQVARELVGDAHVVEQADLLMGSEDFAFMLQQRPGSFVRLGNGE
GEDGCMVHNPKYDFNDRNLPIGAAFWTRLVERYLGQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacgtccgattcaccgaaatcgaggatctgatgcccgccgccggcgggctg
cgcgagattcgccatcacattcaccatcacccggagctcgcatacgaggagcacgacacg
gccgcgctcgtcgccgacaagctcgaacaatggggatggcaagtgacgcgcggggtcggc
aagacgggcgtcgtcggcacgctgcgggtcggcgacggcacgcgcagcatcggcatccgc
gcggacatggacgcgctgccgatcgtcgaggcgacgggccttccgtacgcgagcggcacg
cccggcaagatgcacgcatgcggccacgacggccacacgacgatgctgctcggcgccgcg
caacacctcgcgaagacgcgcaacttctccggcaccgtgcatctgtatttccagccggcg
gaggagcacggcgtcgatagcggcgcgaagaagatgatcgacgacggcctgttcgagcgc
tttccgtgcgacgcggtgttcggcatgcacaaccatccgggcgcggcgccgggcgtgttc
ctcacgcggcgcggcccgttcatgtcggccggcgacaaggcgatcatctcgatcgagggc
gtcggcggccatgcggcgcggccgcacctgacggtcgacccggtggtcgtcgcggcgagc
atcgtgatggcgctgcagacgatcgtcgcgcgcaacgtcgacccgtcgcagccggcggtc
gtcacggtcggctcgatgcatgcgggcaccgcgaacaacgtgatcccgaacggcgcgcgc
ctcgaactcagcgtgcgttcgttcagccccgacgtgcgcgcgctgctcaagcgccgcatc
gtcgagctcgccgagtcgcaggcggcgagttacggcgcgaccgcgcacgtcgagtacatc
gaaggctatccggtcgtcgtcaatacggatgccgaaacggatttcgccgcgcaggtcgcg
cgcgagctggtcggcgacgcgcatgtggtcgagcaggccgatctgctgatgggcagcgag
gatttcgcgttcatgctgcagcagcggccgggctcgttcgtgcgcctcggcaatggcgaa
ggcgaggacggctgcatggtgcacaacccgaagtacgacttcaacgatcgcaatctgccg
atcggcgcggcgttctggacgcgtctcgtggagcgttacctcggacagtaa

DBGET integrated database retrieval system