KEGG   Burkholderia territorii: WS51_12475Help
Entry
WS51_12475        CDS       T04843                                 

Definition
(GenBank) cytochrome C biogenesis protein CcdA
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
btei  Burkholderia territorii
Pathway
btei00730  Thiamine metabolism
btei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    WS51_12475
Enzymes [BR:btei01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     WS51_12475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOI67026
Position
1:377530..378666
Genome map
AA seq 378 aa AA seqDB search
MNLHACRPDFAVLGGGLVGRLIAWRLAGDGHRVALYERGGPDGEQSAAWVAAAMLAPLAE
AASAELLITELGAASLARWPQWLAELPEPVFFQQHGTLVVWHHADRAEAPLFERRVRANA
PAELFDGGFVALAGAQVDAAEPALAGRFARGLMLPREGQLDNRQALRALAAGLAQRGVEL
HWHATIDDANRPDAHFTIDCRGLGAKAVLPALRGIRGEVARVRATGIGLTRPVRLLHPRY
PLYIAPKQDDLYVIGATEVEGEDMSPVSVRSALELLSAAFSVHPAFGEARILELNAQCRP
TLPDHRPAVVWDGATTLAVNGLYRHGFMIAPEVAHAAVAFAQGALGGAFADADAFAAWRD
AARWPTLLHHRDDARQPA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcacgcttgccggccggatttcgcggtactcggcggcggcctcgtcggccgc
ttgatcgcctggcggctcgcgggcgacgggcatcgcgtcgcgctctacgagcgcggcggc
ccggatggcgagcagtcggccgcatgggtcgcggccgcgatgctcgcgccgctcgccgag
gcggcaagcgccgagctgctgatcaccgagctcggcgccgcatcgctcgcgcgctggccg
caatggctcgcggaactgcccgaaccggtgttcttccagcagcacggcacgctcgtcgtc
tggcatcacgcggatcgcgccgaggcgccgctgttcgagcgtcgcgtgcgcgcgaacgcg
ccggccgagctgttcgacggtggcttcgtcgcattggccggcgcgcaggtcgacgcggcc
gagcccgcgctcgcggggcgtttcgcgcgcggcctgatgctgccgcgcgaagggcagctc
gacaaccgccaggcgctgcgtgcactcgcggcgggccttgcgcaacgcggcgtcgaactg
cactggcacgcgacgatcgacgacgcgaaccggcccgacgcgcatttcacgatcgattgc
cgcgggctcggcgcgaaagcggtgctgcccgcgctgcgcggcatccgcggcgaagtcgcg
cgcgtgcgcgcaacgggcatcgggctcacgcggcccgtgcggttgctgcatccgcgttat
cccctctacatcgcgccgaaacaggacgacctgtacgtgatcggcgcgaccgaagtggag
ggcgaggacatgtcgcccgtcagcgtgcgctcggcgctcgaactgttgagcgcggcgttt
tccgtgcatcccgcattcggcgaggcgcgcattctcgaactgaatgcgcaatgccgcccg
acgctgcccgatcatcgcccggcggtggtctgggacggcgcgacgacgctggccgtcaac
ggcctgtaccggcacggcttcatgatcgcgccggaagtcgcgcatgcggcggtcgcgttc
gcgcaaggcgcgctcggcggcgcgttcgccgatgccgacgcgttcgccgcgtggcgcgat
gccgcgcgctggccgacgctccttcatcaccgcgacgacgcgcgccagccggcctga

DBGET integrated database retrieval system