KEGG   Burkholderia territorii: WS51_14695Help
Entry
WS51_14695        CDS       T04843                                 

Definition
(GenBank) hypothetical protein
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
btei  Burkholderia territorii
Pathway
btei00051  Fructose and mannose metabolism
btei00520  Amino sugar and nucleotide sugar metabolism
btei01100  Metabolic pathways
btei01110  Biosynthesis of secondary metabolites
btei01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    WS51_14695
   00520 Amino sugar and nucleotide sugar metabolism
    WS51_14695
Enzymes [BR:btei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     WS51_14695
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     WS51_14695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 Cupin_1 GPI
Motif
Other DBs
NCBI-ProteinID: AOI64906
Position
1:complement(884294..885742)
Genome map
AA seq 482 aa AA seqDB search
MSIVPIIICGGAGTRLWPVSREAFPKPLLKLADGQSLLQKTYLRACGIPGVEEIVFVTNR
DTYFLTKDECAEVRHEAVKMGFVLEPVSRNTAAAIEAAALVVRERHGPEAIMLVMPADHL
INDLAAFNAAVQQASDAAGTGKVVAFGVKPTRAETGFGYIQYERGAHEDTSARDIVSFVE
KPNAEVAARLASDGQHAWNAGIFCFAAQTMLDEMETLAPDVAEPVREAIPDGSWASTDED
YVVELTRTAFETAKDISIDYAVMERTNKAAVVPCDIGWSDIGSWLAISDLSQPDDRGNRI
DGAALLHDTSNCYFRSEDRLIGAVGVEDLVVVDTPDALLIARRDRAQDVKQIVSQLKQSN
HDAYRIHRTVHRPWGTYTVLEEGDRFKMKRIVVKPGASLSLQMHHHRSEHWIVVRGCADV
VNGERVISLQPNESTYIPAGHKHRLINPGVVDLVLIEVQCGEYLGEDDIVRFEDVYGRAP
AT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagttcccatcattatctgcggtggcgcgggcacccgtctttggccggtctcg
cgtgaagcgtttccaaaacctctgctcaagctggcggacggtcaatcactcctgcaaaag
acctaccttcgcgcgtgcggcatccctggggtcgaggaaatcgtcttcgtcacgaatcgc
gatacatacttcctgaccaaggacgaatgcgctgaagttcgccacgaagccgtcaagatg
gggttcgtactcgaaccggtgtcgcgcaacacggcggcggcgatcgaggcagcagcgttg
gtcgtgcgtgagcgccatggtccggaggcgatcatgctcgtgatgccggcggaccatctg
atcaacgatctcgcagccttcaatgcggcggtccaacaggcatcggacgcagcaggcacc
ggcaaggtcgtggcgttcggcgtcaagccgacccgcgctgaaacaggcttcggctatatc
caatacgaacgcggcgcacatgaagacaccagcgcgcgcgacatcgtcagcttcgtcgaa
aaaccaaacgccgaagtggccgcaaggctggcaagcgacggtcagcacgcgtggaacgcg
ggcattttctgtttcgctgcccagacgatgctcgacgaaatggaaacgctggcgcccgac
gttgccgagccggtccgggaggccattcccgacggaagctgggcgtcgaccgacgaggat
tacgtcgtggaactcacgcgcaccgcgttcgagacagcaaaggacatctctatcgactac
gccgtgatggagcgcacgaacaaggcagcggtcgtgccgtgcgacatcgggtggagcgac
attggatcctggcttgctatcagcgacctgagccaaccagacgatcgaggaaaccggatc
gacggtgccgcccttctgcacgacacgtcgaactgctatttccgctccgaagaccgcttg
atcggcgccgtgggcgtcgaggatctagtggtcgtggacacgccggacgcactgctgatc
gcccggcgcgaccgcgcacaagacgtcaaacagattgtttcccaactgaagcagtccaac
cacgacgcctatcggattcatcggacggttcatcgaccgtggggcacgtatacagtgctc
gaagagggcgaccgcttcaagatgaagcgcatcgtcgtcaaacccggcgcgtcgctgtcg
ttgcagatgcatcaccatcgcagcgagcactggatcgttgtgcgcggatgtgcagacgtc
gtcaatggtgaacgcgttatttcgctgcaacctaacgagtcgacatacattccggccggg
cacaagcatcgtctgattaacccgggggtcgtcgatctcgtactcatcgaagtgcagtgc
ggcgaatatctcggagaagacgatatcgtccgcttcgaggacgtctacggacgggcgcct
gcaacctga

DBGET integrated database retrieval system