KEGG   Burkholderia territorii: WS51_26465Help
Entry
WS51_26465        CDS       T04843                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btei  Burkholderia territorii
Pathway
btei00071  Fatty acid degradation
btei00072  Synthesis and degradation of ketone bodies
btei00280  Valine, leucine and isoleucine degradation
btei00310  Lysine degradation
btei00362  Benzoate degradation
btei00380  Tryptophan metabolism
btei00620  Pyruvate metabolism
btei00630  Glyoxylate and dicarboxylate metabolism
btei00640  Propanoate metabolism
btei00650  Butanoate metabolism
btei00900  Terpenoid backbone biosynthesis
btei01100  Metabolic pathways
btei01110  Biosynthesis of secondary metabolites
btei01120  Microbial metabolism in diverse environments
btei01130  Biosynthesis of antibiotics
btei01200  Carbon metabolism
btei01212  Fatty acid metabolism
btei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS51_26465
   00630 Glyoxylate and dicarboxylate metabolism
    WS51_26465
   00640 Propanoate metabolism
    WS51_26465
   00650 Butanoate metabolism
    WS51_26465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WS51_26465
   00072 Synthesis and degradation of ketone bodies
    WS51_26465
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WS51_26465
   00310 Lysine degradation
    WS51_26465
   00380 Tryptophan metabolism
    WS51_26465
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WS51_26465
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WS51_26465
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WS51_26465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btei04147]
    WS51_26465
Enzymes [BR:btei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WS51_26465
Exosome [BR:btei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WS51_26465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AOI67265
Position
3:51437..52630
Genome map
AA seq 397 aa AA seqDB search
MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVSEVLSRANVPGDAVGHVVFGHV
VNTEPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAAQTIMLGDADVAIGGGS
ESMSRAPYSVPSARFGQRMGDAKLVDMMLGALHDPFQTIHMGVTAENVAKKYGISRDAQD
ALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDTDEHVRHDAGPDDFTKLKPVFV
KEDGTVTAGNASGINDAAAAVLMMSADAARAQGVKPLARLVAYAHAGVDPAYMGIGPVPA
THKALERAGLKITDLDVIEANEAFAAQACAVTQELGLDPAKVNPNGSGISLGHPIGATGA
LITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcagcgaaggaagtcgtggtggtgagcggtgtccgtaccgcgatcggcgat
ttcggcgggagcctgaaggatttttcgccgaccgatctcggtgcgaaggtcgtgagcgaa
gtgctgtcgcgcgcgaacgtgccgggcgacgcggtcgggcatgtcgtgttcggccacgtc
gtgaacaccgaaccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggtgtt
gcgcagcatacgccggcgctgaccgtgaaccgcctgtgcggctcgggtctgcaggcgatc
gtgtcggccgcgcagacgatcatgctcggcgatgccgacgtcgcgatcggcggcggctcc
gagagcatgagccgcgcgccgtacagcgtgccgtccgcgcgcttcggccagcgcatgggc
gatgcgaagctcgtcgacatgatgctcggcgcgctgcacgatccgttccagacgatccac
atgggcgtgaccgccgagaacgtcgcgaagaaatacggcatttcgcgtgatgcgcaggat
gcgctcgcgctcgaatcgcatcgtcgcgcggcgcgcgcgatcgcggaaggccgcttcaag
gatcagatcctgccgatctcgatccgcacgaagaagggcgaggtcgcgttcgataccgac
gagcatgtgcgccacgacgcgggcccggacgatttcacgaagctgaagccggtgttcgtg
aaggaggacggcacggtgacggccggcaacgcgtcggggatcaacgatgccgctgccgcg
gtgctgatgatgagcgcggacgccgcccgcgcgcagggcgtgaagccgctcgcgcgtctg
gtcgcgtatgcgcatgcgggtgtcgatccggcgtacatgggcatcggcccggtgccggcc
acgcataaggcgctcgagcgcgcgggcctgaagatcaccgatctcgacgtgatcgaggcg
aacgaagcgttcgccgcacaggcatgcgcggtcacgcaggagctcggcctcgacccggcc
aaggtcaacccgaacggctccggcatttcgctcggtcacccgatcggtgcgacgggtgcg
ttgatcacggtcaaggcgctgtacgagctgaagcgcatcggcgggcgttatgcgctcgtg
acgatgtgtatcggcggcggccagggcattgcggcgatcttcgagaacatctga

DBGET integrated database retrieval system