KEGG   Burkholderia territorii: WS51_27720Help
Entry
WS51_27720        CDS       T04843                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
btei  Burkholderia territorii
Pathway
btei00430  Taurine and hypotaurine metabolism
btei00620  Pyruvate metabolism
btei00640  Propanoate metabolism
btei00680  Methane metabolism
btei01100  Metabolic pathways
btei01120  Microbial metabolism in diverse environments
btei01200  Carbon metabolism
Module
btei_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS51_27720
   00640 Propanoate metabolism
    WS51_27720
  09102 Energy metabolism
   00680 Methane metabolism
    WS51_27720
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    WS51_27720
Enzymes [BR:btei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     WS51_27720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AOI67483
Position
3:complement(334654..335853)
Genome map
AA seq 399 aa AA seqDB search
MRTLALLVVNAGSSSVKFSIFAYPPHGDPVRRPLHDGEAVAAGNGVSIRFDADPDGSLPL
VAGDPYRAVLAQVAMWIRVQLPHIALGAIAHRVVHGGARYVEPVVVNDDVLRALRTLTPL
APLHQPHSLDAIDVLRDAFPDVPQIAVFDTAFHRTLPRVEQLLPLPHAWFDQGVRRYGFH
GLSYEYLSVALAESFGARAHGRVIAAHLGSGASLCALRDCRSVATTMGFSALDGLMMSTR
CGTLDPGVVLHLLEVGKLSGDALGHMLYHESGLKGVSGASGDPRVLLACEAAGDVPARDA
LALYVHRIVRETGALTALLGGLDMLVFTAGIGEHSAQLRERICASLGWLGIALDARANAA
HAHVVSSASSAVTVVVEPTNEAWVAARAAVRVLRGNRDG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctcgcactgctcgtcgtcaacgccggttcgtcgagcgtcaagttctcgatc
ttcgcgtatccgccgcacggcgatcccgtgcggcggccgttgcacgacggcgaggcggtc
gcggccggcaacggcgtgtcgatccgcttcgatgccgatccggacggttcgctgccgctc
gtcgcgggcgatccgtaccgcgccgtgctcgcgcaggtcgcgatgtggatccgcgtgcag
ttgccgcacatcgcgctgggcgcgatcgcgcaccgcgtcgtgcacggcggcgcgcgatac
gtggagccggtggtcgtcaacgacgacgtgctgcgcgcgctgcgcacgctgacgccgctg
gcgccgctgcatcagccgcacagcctcgacgcgatcgacgtgctgcgcgacgcgtttccg
gacgtcccgcagatcgccgtgttcgacacggcgtttcatcgcacgctgccgcgcgtcgag
caattgctgccgttgccgcacgcatggttcgaccagggcgtgcgccgctacgggtttcat
ggcctgtcatacgaatacctgtccgtcgcgctcgccgaatcgttcggcgcgcgtgcgcat
ggccgcgtgatcgccgcccatctcggcagcggcgcgagcctgtgcgcgctgcgcgactgc
cgcagcgtcgcgacgaccatgggtttctccgcgctcgacggattgatgatgagcacccgc
tgcgggacgctcgaccctggcgtcgtcctgcacctgctcgaagtcggcaagctgtccggc
gacgcactgggacacatgctgtatcacgagtcggggctcaagggcgtgtcgggggcgtcc
ggcgatccgcgcgtgctgctcgcgtgcgaggcggccggcgacgtgccggcacgcgacgcg
ctggcgctgtacgtccatcgcatcgtgcgcgagacgggcgcgctgaccgcgctgctcggc
ggcctcgacatgctggtcttcacggccggcatcggcgaacactcggctcaattgcgcgag
cggatctgcgcgtcgctcggctggctcggcatcgcgctcgacgcgcgtgcgaatgccgcc
catgcgcatgtcgtgtcgtccgcgtcgagcgcggtcacggtggtcgtcgagccgaccaac
gaagcatgggtcgcggcgcgcgccgcggtgcgcgtactgcgcggcaaccgcgacggttga

DBGET integrated database retrieval system