KEGG   Bombus terrestris (buff-tailed bumblebee): 100642390Help
Entry
100642390         CDS       T04364                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00250  Alanine, aspartate and glutamate metabolism
bter00330  Arginine and proline metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100642390
   00330 Arginine and proline metabolism
    100642390
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     100642390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100642390
NCBI-ProteinID: XP_003402578
Position
Unknown
AA seq 568 aa AA seqDB search
MLSLCRQALIINSQKVGTRCLGTIIPLPNPAEFPLENEPVLNYKKGSPERAELERALDKM
ASDCEEVPLVIGNEEIKTDLCRYQVMPHNHKAKVAKYHWATPDLVKKAIDVAVKAQREWE
KCPFEQRLEIWLRAADLMATKYRQQLNAATMLGQSKSVIQAEIDSAAELVDFFRMHAYFA
KEALKYQPISTNSKETLNSMRYRGMDGFVAAVSPFNFTAIGGNLSYTPALMGNAVLWKPS
DTALLSNWWIFKICKEAGVPPGVVNFVPCEGPVFGDTITASPHLSGINFTGSVPTFNRLW
AQIGKNLGKYKNYPKLVGECGGKNYHFIHASADVESVINGTIRSAFEFNGQKCSACSRMY
VPESLWPKIKEGLLSLRDALKIGDIRDFTVFTGAVIDATAFKRISGYIEHAKKSPNLKII
GGGKYDDSVGYFIDPTIVETKDPTDKIITEEIFGPVLTIYVYKDSNLDETMKLVESSTPY
ALTGSIFSQDEKWARRALEEFKYTAGNFYVNDKSTGSVVGQQPFGGSRMSGTNDKAGGPH
YVLRWASPQSIKETFVPLREYDYPYMRS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtctttgccgtcaagcgttaataattaacagtcaaaaagttggtacaagatgt
ttaggaacaataataccattgccaaatcctgctgaatttcctttggaaaatgaacctgtc
cttaattataaaaaaggtagccctgagagggcagaattggagagagctttggataaaatg
gccagtgattgtgaggaagtacccctggttattggaaatgaagaaattaaaacagattta
tgtagatatcaagttatgccacataatcataaagcaaaggttgcaaaatatcattgggca
acacctgatctagtcaaaaaggcaatagatgttgctgtaaaggctcagcgtgaatgggaa
aaatgtccatttgaacagcgtttagaaatctggttgagggcagctgatttgatggcaaca
aaatacagacagcaattaaatgctgctacaatgctcggacagagcaaatctgttattcaa
gcagaaatcgatagtgcagcagaattagttgatttctttagaatgcatgcatattttgcc
aaagaggctttaaaatatcagccaatttcaaccaattctaaagaaacattaaattcaatg
agatatagaggaatggatggttttgttgcggcagtatcaccattcaactttactgccatt
ggtggtaatcttagctatacacctgctttaatgggtaatgcagtactctggaagccatct
gatacagctttactttctaactggtggatttttaagatatgtaaagaagctggtgtacca
ccaggtgtagtcaattttgttccatgtgaaggtcccgtttttggtgacactataactgct
tcacctcatctatccggaattaattttaccggatcagttcccacgtttaatcgtttgtgg
gcacaaattggtaaaaatctggggaagtataagaactaccccaaattagtaggcgaatgt
ggcggaaaaaattatcatttcatacacgcgagtgctgatgtagagtcagttattaatggg
accatacgaagcgcttttgaatttaatggtcaaaaatgttcagcttgcagtagaatgtat
gttccagaatcattgtggccaaagataaaggaaggccttttatcacttcgtgatgcactt
aagattggcgacatcagagattttaccgtgttcaccggagccgttatagatgctactgca
tttaaaagaatttctggttatatcgaacatgccaaaaaatcgcctaatttaaaaattatc
ggcggtgggaaatacgatgattcggttggatacttcattgatccgacaatagtagaaaca
aaagaccctacagataagataataacagaggaaatatttggccctgtattaacaatatat
gtttataaagattcaaacctcgatgaaacgatgaaattggtagaatcctcgacaccttat
gctttaactggatcgatattctcgcaagacgaaaaatgggcgagaagagctctcgaagaa
tttaaatatacagctggcaatttctatgttaacgataaatcgacaggctcggtcgttggt
cagcaaccgtttggtggtagtagaatgtctggaacaaatgataaggctggcggacctcat
tacgttcttcgttgggcatcgccacagtcaatcaaagaaacatttgttcctttgcgtgaa
tacgattatccatatatgaggtcttag

DBGET integrated database retrieval system