KEGG   Bombus terrestris (buff-tailed bumblebee): 100643842Help
Entry
100643842         CDS       T04364                                 

Definition
(RefSeq) sphingosine kinase 2 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00600  Sphingolipid metabolism
bter01100  Metabolic pathways
Module
bter_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100643842
Enzymes [BR:bter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100643842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100643842
NCBI-ProteinID: XP_012170271
AA seq 649 aa AA seqDB search
MTDNHQCVMEDGGQVHSNTLLEETFYVTSKKNTYYKVRLTEKGLSLEKDNNGATKIETIV
LNDIIGCRCMRSKRKSAGSCVCGPGTSRSQFKLVESVEAYQSYDEFDTSAYLYIYAYTLK
KARMKGIKRRERTTITLRFRSFDKYEDNLREASRWRLAIKCLIVGLPVPKSFMSPSHENL
ESLISACPGEQRKILVLLNPKSGPGRGRETFQKRIHPILSEAERPYDVHITKCPNYAREF
VRTRDIYQWSGLLMVGGDGIVFEVVNGLFQRPDWEKALKELSLGVIPCGSGNGLAKSIAY
AKQEPYDYNPLLVSALSVVKFKKAQMDLVRVETRNQILFSFLSVGWGLLADIDIESERLR
AIGGQRFTIWTIARLIGLRTYKGKVSYLACDKVPSVENLGNGKAYNEYAQETQISHSRSC
GDDLDRYSKISESKSFHDAIDGDPAIFDGSFDSCDDNEIISDNITLETEAERRQRLDSFY
SATSAKSTYFSTGSISSYHSIDDPNNEDIDPENSSQVMYGPSSRLPALTSEVSNSWTQIE
GEFVMVHAAYQSHLGQDYFFAPRAKLADGVIWLMIIKAGITRANLLQFLLGLNNGTHVTR
SGVDMIPVKAFRIEPEEGANGYITVDGEKVDYGPLQAEIFPSLASVMSP
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaatcatcagtgtgtcatggaggacggtggtcaagtgcattctaacactctt
cttgaggaaacattttatgttacgtcgaagaaaaacacttactacaaggtgagactaaca
gaaaagggtctcagcttagagaaagacaataatggtgcgacgaagattgaaacgatcgtt
ctaaacgacataatagggtgcagatgtatgcgttcgaaacgcaaaagcgcgggaagctgt
gtttgtggaccaggtacctcgagatctcaatttaagctggtcgagtctgtggaagcatat
caatcctacgatgagtttgacacttcggcctatctttatatttatgcgtacacgctgaag
aaggcacgtatgaaaggtatcaagagacgagaaaggaccacgattacgctacgattccgc
agctttgacaaatacgaagataatctacgagaggccagcaggtggcgattagctataaaa
tgtctcattgttggcttgcctgtgcctaaaagttttatgagccccagtcacgagaatctg
gaatcgttgattagcgcgtgtccaggtgagcaacgaaagattctggtgttgctgaatcca
aagtcaggaccaggaagaggtcgagaaacgttccagaaaaggatccatccgattctatcg
gaagctgagaggccttatgatgttcacatcaccaagtgtcccaattacgcacgcgagttc
gtgcgtacgagggacatctatcaatggagcgggctgctgatggtcggaggcgacggtatc
gtgttcgaagtagtaaatgggctttttcaaaggcccgattgggagaaagctctgaaggaa
ttatcccttggtgtgataccctgtggttccggtaatggtctggcgaaatccatcgcgtac
gctaaacaggagccgtacgattataatcctcttctcgtcagcgcactgtccgtggtgaag
tttaaaaaggctcagatggacctggtacgcgttgaaacaaggaatcagattctattttcg
ttcttatcggtcggctggggtttactcgccgacattgacattgagagtgaacgtctccgt
gcaataggcggtcagagattcaccatatggactatcgcccggctgataggtttgaggaca
tacaaaggaaaagtatcttatttagcttgcgataaagtaccgtccgtggagaatttgggt
aatggcaaggcctacaatgagtacgcacaggaaacgcagatatcgcattcaaggagctgt
ggcgatgatttagatcgatacagcaaaatcagtgaatcgaaaagcttccatgatgcaatc
gatggagatcctgctatttttgatggatcgtttgatagctgtgatgataacgaaataata
agcgataatatcactctggaaacagaagctgagagaagacagaggctagacagcttctac
tctgcgacatccgcaaagtcaacttattttagcacgggatcaatttctagttaccatagc
atcgatgatcccaataatgaagatattgatccagagaacagtagtcaagttatgtatggt
ccatcctcaaggctgcctgctctaacttcagaagtatcaaattcttggacgcaaattgaa
ggagaattcgttatggttcacgcggcatatcagtctcatttgggccaggattatttcttt
gcacctcgtgccaaattggcggacggtgttatttggcttatgataataaaagccggaatt
actcgagctaatttactccagttcctgttgggattaaataatggtacccatgtaacacgg
tctggcgtcgacatgataccggtaaaggcgtttcgaatagaaccagaagaaggagcgaac
ggttacattacggtggatggagaaaaagtagattatggacctttgcaagccgagatattc
ccatctttagcgtcggtaatgtctccttga

DBGET integrated database retrieval system