KEGG   Bombus terrestris (buff-tailed bumblebee): 100643871Help
Entry
100643871         CDS       T04364                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00511  Other glycan degradation
bter00600  Sphingolipid metabolism
bter01100  Metabolic pathways
bter04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100643871
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100643871
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100643871
Enzymes [BR:bter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100643871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Alpha-L-AF_C Glyco_hydr_30_2
Motif
Other DBs
NCBI-GeneID: 100643871
NCBI-ProteinID: XP_003402892
Position
Unknown
AA seq 510 aa AA seqDB search
MGHAWRALLLITFFFNKGIANDCVPYRIDNEVIACVCNATYCDGLPDGIPEVPDEGNSYW
YVTNKQGLRMKMSEVKFDSCENFPVDVTLTIDNTKKYQTIXGFGGAFTDSTDINIAKLSP
ATQLQLIRAYYHPKKGSRYTLGRIPIGASDFSARPYTYDDTANDTTLKHFILANEDFDYK
LLYARKVLEFNSEIKFFGAAWTAPLWMKSNDNGLTFLKEEYYQIYADYLLKFLDEYKNNG
IDIWAITTGNEPQIAFMVKIPLNTMGWEPESMANWIANNLGPTLASSPHNETLIFAFDDS
RKALPKFVEPTFRNQNANKYVAGTAVHWYQDSETPADILDQTHDEFPDKLILMTEASVIG
PPIWNTSKVKLESWRRGEKYILSIIEYMNHWSIGWVDWNLALDETGGPNFVNNYIDAPII
VNPKTDEFYKQPMYYAVKHFSRFVDRGSVRISITDTDTIKSAAFVTPSAENVVVLYNRDT
SPRHVVLKDVQKGTLCLELSPQSMNTLKYK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggacacgcgtggagagcacttttgctaattactttcttcttcaacaaaggtatcgcg
aatgactgcgtgccgtatcgtatagataacgaggtaatagcatgtgtttgcaatgcaaca
tattgcgatggattaccagatggtataccggaagttccggacgaaggtaattcttattgg
tatgtgacgaataaacaggggctgagaatgaaaatgtcagaagtaaaatttgatagctgc
gaaaatttccccgtggacgtaacgctgaccatagataatacgaaaaagtatcaaacgatt
nttggcttcggtggcgcatttaccgattctactgatataaacatagcaaaactcagccca
gctactcaacttcaattgattcgagcatattatcatccaaagaaaggaagcagatacaca
ctgggtcgtatacctattggggcgagcgatttttcagcaagaccgtatacgtatgacgat
acggccaatgacaccacgcttaaacactttatacttgcgaacgaagatttcgattacaaa
ctactatatgcaaggaaagtgcttgaattcaattccgaaattaaattcttcggtgctgca
tggaccgcaccattatggatgaaaagcaatgacaacggactcactttcttaaaagaagaa
tattaccaaatctatgctgactatctgctaaagttcctggatgaatataaaaacaacggt
attgacatatgggctattacaactggtaacgagccacagattgcctttatggttaaaatt
ccacttaacactatgggatgggaacccgaatcaatggctaattggatcgctaacaatttg
ggtccaacattagcatcatcgccgcacaatgaaacactaattttcgcctttgatgacagt
agaaaggcattacccaaatttgtcgaaccaacgttccgaaatcaaaatgcaaacaaatac
gttgccggaacagctgtacactggtatcaagattccgaaactcctgcagatatattagat
caaacccacgatgagttcccagacaaattaattttaatgaccgaagcgtctgtaatagga
cctccaatatggaacacttcgaaagttaaattggaatcgtggcgtcgaggtgaaaaatac
attttaagcataatagagtacatgaatcattggtcaattggatgggtggattggaattta
gccttggacgaaactggtggaccaaactttgttaataattatatcgacgcccctattatc
gtcaacccgaaaaccgatgaattttataaacaacctatgtattatgccgtcaaacatttt
agcagattcgttgacagaggttctgttagaatttctattaccgatactgatactatcaaa
tctgcagctttcgttacaccttcagcggaaaacgtcgttgtcctatacaatagggatact
tctccaagacacgtagttttgaaggatgtacagaaaggtacactttgtttagaattatct
ccgcaatctatgaatactctgaaatacaaatag

DBGET integrated database retrieval system