KEGG   Bombus terrestris (buff-tailed bumblebee): 100644766Help
Entry
100644766         CDS       T04364                                 

Definition
(RefSeq) soluble guanylate cyclase 89Da
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00230  Purine metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100644766
Enzymes [BR:bter01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100644766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 100644766
NCBI-ProteinID: XP_003397617
AA seq 631 aa AA seqDB search
MYGMLLESVQHFVQLEYGEDVWLQLLERADCKHMVFNTRQTYPDELMTNLAAALAECNGE
SVEDVMQFFGKCFVRFFSNLGYACMIKATGRYFCDFLQNVDNIHMQMRFTYPRMKSPSMY
TTHVDPQGVVLVYRSTRKGFTHYLMGQLFQIAKELYETDLVIRVLGSSNNIPGSRSVMVK
FRIDFDNREYIAKNNSMKTPLGRELAPVSISFLLRLFPFGVVINKDMRILGAGDKLLQAW
GGSSSILNKHVTDVFKFRRPKGISFTWGNVMYLHSVMFELELVRLNDNDASSNSDNTPST
SSGLDRRGSQGARSILLKGQMRYIEDLKAIIFLCSPLINSLDELLNMGLYLNDLNTHGLS
RELVLAGWQHCGRLEMMFERAEQRSTELENSYALLDRWKNKSDELLYSMIPQTVADRLRA
GACPLSTCESFESISVLFCELCDFDYSTIEGAMDIVSSMNAVFSCFDSLMDEFNVYKVET
VGRVYMAASGAPDRTENHAQNIADVSLQLLKHVRSLKLPSGVDIQIRIGIHSGPAVAGVV
GIKVPRYCFFGDTVNTASRMQTTSLPGKVQISSDVKALLPPDRYYVESRGLVWVKGKGNM
ETYWLSDKVDTDGKSTEQQATKPEGLLVTDI
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtacggtatgctgttggagagtgtgcagcacttcgtgcagttagaatacggcgaggat
gtgtggcttcagctcctggaaagagctgattgcaaacatatggttttcaacacgcgacaa
acgtatcccgacgagcttatgaccaatttagctgctgcattagccgaatgcaatggtgaa
tccgtggaggatgtaatgcaattctttgggaagtgtttcgtaagattttttagcaactta
ggatatgcctgcatgataaaggccactggacgttatttttgtgactttctacaaaacgtc
gacaatattcacatgcaaatgagattcacgtatccacgtatgaaaagtccttcgatgtac
actacgcacgtcgacccacagggtgtagtattagtttatcgaagcactaggaagggattt
acgcactatcttatgggtcagttatttcaaatagcgaaagagctttacgaaacagattta
gtcatacgagtattaggaagttcaaacaatatccctggatccagaagcgtaatggttaaa
tttagaattgatttcgacaatcgtgaatacatcgcaaagaacaacagtatgaaaactcca
cttggccgtgaattagcaccggtgtcaatatcgttccttttacgtcttttcccatttgga
gtggtaatcaacaaggacatgaggatattgggggccggtgataaactcctgcaagcatgg
ggtggcagttcgtccattttgaataaacacgtcacggatgtttttaaattccgtaggcct
aaaggaatatctttcacgtggggaaatgtgatgtacttgcattctgtgatgttcgaattg
gagctggtcagattaaacgataacgatgcttcatctaactcagacaataccccaagcacc
agttcgggattggataggcgcggcagtcaaggagccaggagcatactattgaaaggtcaa
atgagatatatcgaggatcttaaagcaattattttcttatgtagtcccctaattaacagt
ttagacgaattgcttaacatgggcctgtacctgaacgacctaaatactcacggcttgagt
cgtgagttagtactcgccggatggcaacattgcggaagattagagatgatgtttgagagg
gctgagcagagatcaaccgaattggaaaacagctacgcgttgctggatcgctggaagaat
aagagcgacgagcttttgtattccatgatcccacagacggttgctgatcgattgcgtgct
ggagcttgtcctttaagcacttgcgagtcattcgagtctatctccgtgttattctgcgag
ctttgcgacttcgattattcgacgatcgaaggtgcaatggacattgtctcatcgatgaac
gctgttttttcttgtttcgactcgctgatggatgaatttaacgtatacaaagtagaaaca
gtcggccgggtctatatggcagccagtggtgcgccggatagaacggaaaatcacgcgcaa
aatatcgcagacgtttcgctgcagctgctgaaacacgtccgatcccttaagttaccctct
ggtgtcgatattcaaattcgtatagggatccattccggaccagctgtagcaggtgtagtt
ggcatcaaagtacctagatattgctttttcggtgacactgtgaatactgcttctaggatg
caaacgactagtctgcctggaaaggtgcagatctcatcagatgtgaaagcgttattacca
ccggatcggtattacgttgaatcacgcggattggtttgggtcaagggtaaaggtaacatg
gaaacttattggttatccgacaaagtagacacggatggtaaatcgaccgagcaacaagct
actaaaccggaaggacttctagtcactgatatttaa

DBGET integrated database retrieval system