KEGG   Bombus terrestris (buff-tailed bumblebee): 100645525Help
Entry
100645525         CDS       T04364                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bter04131]
    100645525
Membrane trafficking [BR:bter04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100645525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 100645525
NCBI-ProteinID: XP_003397384
AA seq 1988 aa AA seqDB search
MSSVQRAFTQKLSKQHAADVRRQIATSTSYSRDLSKSGSSFSGFSSTMSLCEVLEPLDYE
EFLAQHQSVLDRDPLKSILDFPPGDVELKVVKRKIRTEEPIVPHESMDIVSPYVRRCIES
FTSDWIIVHRKYKRRVSPIARDRLLQDTPRQDFEVDQEDTNGSGSPNEEEDLSNCGDTPR
GSWASLDLRHSQHDPLLPSLLDRVCPETIDQMNEQKRSEDRQEALFPLYAPPASPDDEWQ
EIGIAPEPTEPFSHKILVKCLQLKLELEVEPIFASLALYDAKEKKKVSENFYVDMNSEGL
KRMLGSHIAYSDASTLARSCVMSISKPSPDLFLVVRLEKVLQGDISECAEPYLREDKNKE
KVRAAAAAACERLGRYRMPLAWTAIHISGVIGGGGDTDSTGSAGSLDRKSGGLEQWRKKV
EPPARRGSLERRSSDKRRSWSPDDFANCLDTFRPITLTVSSFFKQESERLRDEDLYKLLV
ELRRPGSNLKRLKCLPGILKLDLSPRPEELPRCLDPDLRRLVPYPDEKSRPVKEILEFPS
EVISPDLTYRNLLYIYPKEANFSSRTGSARNIAVRIQLMGGEQEADALTAIFGRSSCPEM
THECFTSVSYHNKNPNFYDEVKIRLPADLSAKHHLLFTFYHISCQKKAEQPNVETAVAYT
WLPLLRDGHLQSGEFSLPAMLDPPPANYSYIAPDVLLPGTRWVDAHRGVFTVILEPVSSV
HPQDKYIDRFLSLCGFLETGQVPPRIGEAGMESELKSALLELARASHSALVRSLPQLLDQ
LISLLVRPPTLPSQPLNVAATVFEAIGLLVRNITNLPDGQLDAHGRHALLATYIAYQCSL
PRMTHAPGIVRAQSNPDLPLEDLEMEVHSRGLDRTASMRQESPSINSQPTRRLLHEELAL
HWVVSTGQARELAVTYSWFFLELIVRSMVVTLAEMGMLEAPRKSRFSPQFCDDVATLTAT
LTSEVTSRCGKENRVPNNLISSLGNFLSDLLSVMDRGFVLSLTRAACCSLSDASMHIPDS
AALYALKLDLVRTICSHEHYVALNLPFGTGYTSGSAPASPSPSTGSSGSLISTLVPGDRA
RFSELSQEFRQQHFLVGIVLSDLSNTLEIPNPMLQNKAIGTIRHLMACHDVDSRYSDPAA
KARVAALYLPLLNIIMDALPQLYHWDSKDKSVYPDESGSITQSVALAIAGGVSADTAGTQ
CRVSLSSEATRHLLMCVLWVLKGLEQSALAQWCSELSSRRILCLLQVLNIATAAFEYKGK
KALKRLPPQAAATSDIRSRLEDVILGQGSARSEMMLRRKERMSGDKLRWRKDQMPYRSCE
QSEGRAVEQDAHIEGALAAEASLVVLDTLETVVQADGGGGAVVGAVLKVLLRALARNQST
SVLQHMFNTQRALVFKYHSALFDEESERCGDLCLTLLTRCSSPLSAVRSHAAASLYLLMR
QNFEIGNNFARVKMQVTTSLSALVGRGRAPSEGALRRALKTVLVYAERDTELADTSFPEQ
VKDLLFNLHMILSDTVKMKEFQEDPEMLLDLMYRIAKGYQGSPDLRLTWLANMAQQHMER
KNHTEAAMCLVHSAALVAEYLHLLEPGGGGRPVGAVALAPITPNALEESAVGDDVLARRE
EGLCLGPDFSESGLAGLLEHAASSFHTAGMYEAIPDVYKVLLPIAEAAHDYKKLANIHGK
LHEAYTRVEQLAGKRVFGTYFRVGFYGGRFGDLAGEEFVYKEPTLTKLPEIFSRLENFYA
ERFGAENIVIIKDSNPVDSSKLELDKAYVQITYVEPYFEPHELRHRPTIFHRNFNIKRFV
YATPFTPGGKAHGELREQCKRKTILTVATHFPYLKTRIRVVARKQIVLSPIEVAIEDIQK
KTAEVAAATAQEPPDAKMLQMVLQGCIGTTVNQGPAEVAVVFLSGLREQNAQPTRLQHKL
RLCFKDFSKKCLDALKRNKNLIGPDQRDYQRELERNYQRLTERLSPLIAWSGPSLTNQQS
VPSTSPRW
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgtgcagcgggcttttactcaaaaattgagtaaacagcatgcagctgacgtt
agacgtcagattgctacctctacctcatattcacgtgatctgtcaaagagtggcagctca
ttctcaggcttttcttccacgatgtcactatgtgaggtattagagccactagactatgaa
gaatttttggctcaacatcagtcagttcttgaccgtgatcctcttaaatcaatattagat
tttccacctggtgatgttgaattaaaagttgtaaaaagaaaaatcagaacagaggaacca
attgtgcctcatgaatctatggacatagtatctccttatgtcagaagatgtattgaaagt
ttcacttcagattggataatagtacacagaaaatataaacgtcgagtttctcccatagca
agagatagacttcttcaggatactccaagacaagattttgaggtggatcaagaagataca
aatggttcaggatcaccaaatgaagaggaagatttatctaattgtggagatacaccaaga
ggatcgtgggcaagtttagatttaagacattcgcaacatgatcctcttcttcccagctta
ttggacagagtttgtccagaaaccattgatcaaatgaacgagcaaaaacgatcagaagat
cgtcaagaagcattatttccactttatgcacctccagcttctccagatgatgaatggcag
gaaattggcatagcaccagaacctacagaacctttttcacataaaattcttgtgaaatgt
ctccaactgaaattggaattggaggttgaaccaatattcgcgagtttagctttatacgat
gccaaagaaaagaagaaggtatctgagaacttttatgtagacatgaattcggaaggctta
aaaaggatgcttggtagtcatattgcatacagtgatgccagtactttagcaagaagctgt
gttatgagtattagcaagcctagtccagatttatttttagtcgttagacttgaaaaggta
ttgcaaggtgatatctctgaatgtgctgaaccatatttacgtgaagataaaaacaaagaa
aaagtacgggcagctgctgcagctgcatgtgagcgtttaggtcgatatagaatgccactt
gcatggactgccattcacatttctggtgtgataggaggaggtggagatacagatagcaca
ggaagtgctggatctttagacagaaaatcgggtggactggaacagtggcgtaaaaaagtg
gaaccgcccgccagaagaggatctttagaaagaagaagttcagataaaagacgtagttgg
tcgccagacgattttgctaattgtcttgatacatttaggcctatcacattgactgtttca
agtttctttaaacaagaaagtgaacgactgagagacgaagatttatacaaacttttagtc
gaactacggagacctggttctaatttaaagagattaaaatgtttaccaggtatactaaaa
ttggatcttagtcctagaccagaagaattgcctagatgcttggatcctgatctcagaagg
ttagtgccatatcctgatgaaaaaagtcggccagtcaaagaaatacttgaatttccaagc
gaagttatttcgccagatttgacgtatcgaaatctcctatacatttatccaaaggaagca
aacttcagttcaaggactggttctgcacgaaacatcgccgtaagaattcaacttatgggt
ggtgaacaggaggctgatgcactaacagctatttttggaagatcatcgtgtcccgaaatg
actcacgaatgcttcacttccgtttcttatcacaataagaatccaaacttttacgacgaa
gtgaaaattcgacttcctgctgatttgagtgcaaaacatcatttgctatttacgttttat
catattagttgccagaagaaggcggaacaaccgaatgttgagactgctgtagcatatacg
tggttgccacttttgagagatggacatctacaatcaggggaattcagtctacccgcgatg
ctggatccaccaccagcaaattattcatacattgcacctgatgttcttctaccaggtaca
agatgggtggatgctcatagaggtgtttttactgtgattttggaaccagtttctagcgtt
catcctcaggataaatacattgatagatttctatcactgtgtggtttcttggaaactggc
caagtacctccacgtattggtgaagcaggaatggaatcggaattaaaatcagccctattg
gaattggcaagagcatcacattctgctttggtacgatcgctacctcaattgctagatcaa
ttaatatccctattagtgcgacctccaacattaccatctcaaccactgaatgtggcagca
accgtattcgaggctataggtttgctagtacgaaatattaccaatctacctgatggtcaa
ttagatgctcacggaagacacgcgcttctagcaacctatattgcttatcaatgctcttta
ccaaggatgacacatgctcctggtattgttcgagctcaaagcaaccctgacctgcctcta
gaagatttagaaatggaggtacactccagaggattggatcgaacagcctctatgcgtcaa
gaatcgccttctataaatagccaacctaccagaaggcttctacacgaagaactagcgtta
cattgggttgtatcgacaggacaggcacgagaattggctgttacatattcatggttcttc
ttggaattgatcgttcgctctatggttgtgacattagcagaaatgggaatgttggaggct
ccccgaaagtcgagattctctccccagttctgtgatgacgtggcaacacttactgcaaca
ttaacttcagaggtgacttcacgatgtggaaaggagaacagggtacccaataatctaata
tcgagtctaggcaattttctttctgatctactatcagtgatggatagaggattcgttttg
tccctaactcgtgctgcctgttgctctctgtcagatgcatctatgcacattcccgattca
gctgcactttatgcgttgaaattggacctcgtacggacaatatgctctcacgagcattac
gtggcactgaatttgccgtttggaactggatatacgtcgggatcggcgccagcttctccc
agtccatcaactggaagttctggcagtctgatatctaccttagtacctggagatcgagct
agattttctgagctcagtcaggagttccgacagcaacactttttagtaggaattgtttta
tcagatttgtcaaatactctagaaataccaaatcctatgcttcaaaacaaagctattggg
accattcgacatcttatggcgtgccatgacgttgattcacgatattctgatcctgctgcg
aaagctagagtcgctgctctctatctgccacttttgaacattataatggatgctctacca
caactctatcattgggattcaaaggacaagagcgtttatcctgacgaatctggttctatt
acacaatctgtggctttagccatagctggtggagtttctgcagacactgcagggactcaa
tgtagagtttccttgagttcagaggctacaagacatctcttgatgtgtgtcttgtgggta
cttaaggggttggaacagtctgctttagcacagtggtgttcagaactaagttctagacgt
atactgtgtcttcttcaagttctcaatattgccactgcagcttttgaatataaagggaaa
aaggcgctgaagagactgcctccacaggcggcagctacgagtgatattcgatctagattg
gaggatgtgattcttggccaaggaagcgccagaagcgagatgatgttgagaagaaaagag
agaatgagtggagacaaacttaggtggcgtaaagatcagatgccttatagatcctgcgaa
cagtcagaaggcagagctgtggagcaagatgctcatatagaaggtgcattagcagcagaa
gcttctctagtagttttggatactttagaaacagttgtccaagctgatggaggaggaggt
gcggttgtaggagctgtattaaaagtgcttttgagagcattagcaagaaatcagagtaca
tctgtgttacaacatatgtttaatactcagagagctttggtatttaagtatcatagtgct
ctgtttgatgaggaaagcgaaagatgcggtgatctgtgtttgacactactcactagatgc
agctcacctctaagtgctgttcgaagtcatgctgctgccagtctttatttattaatgagg
caaaatttcgaaattggaaacaattttgccagagttaaaatgcaagtaaccacatctttg
tctgcccttgttggaagaggaagagctcctagtgaaggagcacttaggagagcattaaaa
acagtgttagtatatgctgaaagggacacagaattagcagacacaagctttccagaacaa
gtgaaggatcttttgttcaatctacatatgattctgtctgatactgttaaaatgaaggaa
ttccaggaggatccagaaatgcttttagatctcatgtatagaattgcaaagggatatcaa
ggttcaccagatcttagactcacatggttggcaaatatggctcaacagcatatggaaaga
aagaatcacacagaggcagctatgtgtttagtgcacagtgctgctttagtagcagaatat
ttacacctcttggaaccaggaggtggcggacgaccagtaggagctgttgctttagctcct
atcacaccaaatgctttagaagagagtgcagtaggagatgatgtactggcaagaagagag
gaaggtttatgtttaggaccagacttttcagaaagtggtttagctggtttgctggaacat
gctgccagctcttttcatacagctggaatgtatgaagctattcctgacgtatacaaggtg
ctgcttccaatagcagaagccgcacatgattacaaaaaattagctaacattcatgggaaa
cttcatgaagcatatacacgagtagaacaattagcgggaaaacgagtatttggaacatat
ttcagagtaggattttatggtgggcgttttggtgatcttgctggtgaagaattcgtttat
aaagaaccgactttgacgaaattaccagagatattctcgagactcgagaatttctatgct
gaacgatttggcgcggaaaatatcgtgataataaaagattcgaaccctgtagactccagc
aagttagaactagataaagcctatgttcagatcacatatgtagaaccatatttcgagcca
catgagctcaggcatagaccaactatttttcataggaattttaatattaagcgatttgta
tatgcaacgccatttactcctggtggtaaagctcatggagaattaagagaacagtgcaaa
cgtaaaactatactaacagtagctacacactttccttatctaaagacaaggattcgcgtg
gttgctaggaagcaaatagttttaagtccaattgaagttgcaattgaagatatacaaaag
aaaactgcagaggttgcagcagctacagctcaagaaccacctgatgcaaagatgctgcag
atggttcttcaaggttgcattggaacaacagttaatcaaggtcctgcagaagttgctgtt
gtgtttctttctggattaagggaacagaatgcacagcccactcgactgcagcataaatta
cgcctatgtttcaaggatttctcaaagaaatgtctggatgctttgaaaagaaacaaaaat
ttaattgggccagatcaacgagactatcaacgagaattggaaagaaattaccaaagatta
acagaaagactttctcctcttatcgcatggagtggaccttcattaacaaatcaacaaagt
gtaccatcaacatcacctcgttggtaa

DBGET integrated database retrieval system