KEGG   Bombus terrestris (buff-tailed bumblebee): 100645670Help
Entry
100645670         CDS       T04364                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00061  Fatty acid biosynthesis
bter01100  Metabolic pathways
bter01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100645670
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100645670
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     100645670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD Sacchrp_dh_NADP NmrA Polysacc_synt_2 RmlD_sub_bind 2-Hacid_dh_C NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 100645670
NCBI-ProteinID: XP_003394318
AA seq 246 aa AA seqDB search
MVAGKVAFVTGAGSGIGREVCRILARQGAKVIATDQNLKSAEDTITSLNDSNHLALNVEV
SNKQSIQEAFKNAISKYSTAPTIIVNSAGITCNQFILKLTSEDFAKVLDVNLKGTFYIIQ
TAVKEMINANVSTSGSIVNVSSIIGKIGNIGQANYAASKAGVIALTQTASLEFGQFGIRV
NTVLPGFIETPMTKTVPDKIKQLFLKKIPLQRKGKPEEVAEVIAFLTSSKSSYVNGASIE
VTGGMH
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggtagccggcaaagtggcctttgtaacaggtgctggtagcggtataggtagagaagta
tgccgtattttggcaagacaaggagctaaggttattgctacagatcagaacttaaaaagt
gctgaagataccattacatccttaaatgattccaatcatttggcattaaatgttgaagtg
tcaaacaaacaaagtattcaagaagcgtttaaaaatgcaataagtaaatattcaactgca
cccactattatagttaattctgcaggaatcacgtgtaatcagttcattttaaaactcaca
agtgaggattttgctaaagtacttgatgtgaatttaaaaggaacattttacataattcag
acagcagtaaaagaaatgattaatgctaacgtaagtacaagtggttcgatcgttaacgta
agctctatcattggaaaaattggaaacatcggtcaagctaattatgcagcatcaaaagct
ggagtaatagctcttacacaaactgcttctttagaatttggacaatttggaattcgtgtt
aatacagtgttgccaggttttatagaaacccctatgacaaaaactgtacctgataaaata
aagcagttatttttaaaaaaaatacctcttcagagaaagggaaaaccagaagaagtggca
gaagtaattgcatttttaacatcttccaaaagttcctatgttaatggtgcttctattgaa
gttacaggagggatgcattaa

DBGET integrated database retrieval system