KEGG   Bombus terrestris (buff-tailed bumblebee): 100645686Help
Entry
100645686         CDS       T04364                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00670  One carbon pool by folate
bter01100  Metabolic pathways
bter01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100645686
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     100645686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR Vac14_Fab1_bd
Motif
Other DBs
NCBI-GeneID: 100645686
NCBI-ProteinID: XP_003399960
AA seq 317 aa AA seqDB search
MKKFVSKHKVRDSGIDDECDNIADHFRSIDTKREMIDLRKKLQDIINIDAIFCSFEVIPV
ISKDLLQSFFTEMNKYHPLFYALTWHKNDMKDYLSLDIINILPNNTLLHLIAKDLTSTDV
KIILKEALEHGIRNIFVLRGDSTKSNSEFSHAIDLVRFIRNQFGNIFCICVAGYPEMHPE
SSSKEMDLIYLKEKVDAGANFIMTQIVFEASIFIKFVNDCRNIGINIPIIPGIFPILNYT
CLQKMAKICNIKIPKIILNTLECIKDNDEEVHNYAVEIATNIIKKIIASKTACGFHFFTL
NKPSLSLEICDKLNIFH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgtgtcgaaacataaagtgcgtgattcagggattgatgacgaatgtgat
aatattgccgatcattttcggtctatagatactaaacgcgaaatgattgatttaagaaaa
aagctacaagatataatcaacatagatgctatattttgtagtttcgaagtgatacctgta
ataagtaaggatcttttgcaaagcttttttacagaaatgaataagtatcatccacttttt
tatgcattaacatggcataaaaatgatatgaaagattatttgtctttagatataattaat
atactcccaaataacacgctccttcatcttatagctaaggatttaacttccactgatgta
aaaattatattaaaggaagcattagaacatggcatacgtaatatttttgtgttaaggggt
gattcaacaaagtcaaatagtgaattttcacatgcaattgacttggtacgttttatacgg
aatcaatttggtaatatattttgtatatgcgttgctggttatccagaaatgcatccagaa
tcatcgtctaaagaaatggatttgatttatttgaaagaaaaagttgatgctggtgcaaat
tttattatgacacaaattgtctttgaagcaagtatttttattaaatttgtgaatgattgt
agaaacattggaattaatattccaattatcccaggtatttttccaattttgaattataca
tgtctccaaaaaatggccaaaatttgtaatatcaaaatacctaaaattattttaaatact
ttggaatgtataaaagataatgatgaagaagtacacaattatgcagtagaaatagctaca
aatattataaaaaaaattattgcaagtaaaactgcttgtggattccatttcttcacatta
aataaaccatcattatcattggagatatgtgataaacttaatatctttcactaa

DBGET integrated database retrieval system