KEGG   Bombus terrestris (buff-tailed bumblebee): 100646157Help
Entry
100646157         CDS       T04364                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC16 isoform X1
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100646157
Enzymes [BR:bter01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     100646157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC MCU
Motif
Other DBs
NCBI-GeneID: 100646157
NCBI-ProteinID: XP_003401099
AA seq 365 aa AA seqDB search
MVRIKWSLTKAPNILKLNLKQKWWRFQVIIKSLFYNEFLNWSYVCDILLEPMFWFVENFT
ACLGPVFVVMVSLLTASIVYIAYYIGLPYWWEKSPLMTIILLVIGNWLLVNVCFHYYMGV
NVPAGYPPEGGLIPEAVSICKKCIKPKPPRTHHCSVCNKCILKMDHHCPWLNNCVGHHNH
RYFFQYMVFTVLGILFIMLFGVEIAYQEFFPAQEPELDGHPVRINNSEIIPVSESLDHLS
EEELAEIAKQAADTSIKEWNRRLIVFAALICVATFAALGALTWWHAGLITRGETSIEARI
NSTETQKYKALGKIYQNPYNFGPRQNWKLFLGIIGRSWWHVLFPSNHGPYGDGLTWKTIH
DTKIS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtacgaataaagtggtctttaactaaagcgcctaatattcttaaacttaatttaaaa
caaaaatggtggcgttttcaagtcattataaaatctttattttataatgaatttttaaat
tggagttacgtttgtgacatacttctagaaccaatgttctggtttgtagaaaattttact
gcttgtttaggaccggtatttgtagtaatggtaagccttttaactgcaagtatcgtgtat
attgcatattacattggtctaccatattggtgggaaaagagtccattgatgacaataatc
ctcttagtgattggaaattggctattagtaaatgtatgttttcattattatatgggagta
aatgtcccagctggttatccaccagaaggtggtcttataccagaggctgtgagtatttgt
aagaaatgtattaaaccaaaaccacccagaacgcatcattgctctgtatgtaacaaatgt
attcttaagatggatcatcactgcccatggttaaacaattgtgttggtcatcataatcat
agatacttttttcaatatatggtttttacagtacttggtatcttattcataatgttattt
ggtgtagaaatagcatatcaagaattctttccagcacaagaaccagaattagatggtcat
ccagtacgcattaataattctgagataattcctgtgtctgaatcactagatcacctaagt
gaagaggaattagctgaaatagctaaacaagctgcagatacaagcattaaagaatggaac
cgtcgacttatagtttttgcagcgctaatttgcgtggctacttttgcagcattaggagct
ttaacatggtggcacgcgggtctcattactagaggagaaacaagtatagaagcacgtata
aatagcacagaaacacaaaagtataaagcacttggtaaaatatatcaaaatccatataat
tttggaccaagacaaaattggaagctgtttctaggtataattggcagaagttggtggcat
gtactttttccatctaatcatggaccatatggagatggtctcacatggaagaccattcac
gatacaaaaatatcttga

DBGET integrated database retrieval system