KEGG   Bombus terrestris (buff-tailed bumblebee): 100646178Help
Entry
100646178         CDS       T04364                                 

Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00740  Riboflavin metabolism
bter00860  Porphyrin and chlorophyll metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100646178
   00860 Porphyrin and chlorophyll metabolism
    100646178
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     100646178
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     100646178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD TrkA_N
Motif
Other DBs
NCBI-GeneID: 100646178
NCBI-ProteinID: XP_003395604
AA seq 201 aa AA seqDB search
MNRIVIFGATGNTGLCALNSAVNKGLNIRAFVRDESKVPTNLKDKIEIVVGDVTNAEQVS
NAISNRDAVVVVLGTRNDLGPTTVLSNGMKNIIDAMKVHNVEIVSVCLSAFLFYKPEAVP
NIFKDVNADHQRMFDLLKESKLKWIAILPPHFTNVQRSKYVVKHDESPGRTISIHDLGDF
LIESLQQPEHYQKVCGIANIA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatagtgatatttggagctacaggaaataccggactatgtgctttaaatagc
gccgtaaataagggattaaatataagagcatttgtaagagatgaaagcaaagtaccaaca
aatttaaaagataaaattgaaatagttgttggagatgttaccaatgcagaacaagtttca
aatgcaatatctaatagggacgcagtggttgttgtgcttggcacacggaatgatttaggt
ccaactacagtattgtccaatggtatgaaaaatataatagatgccatgaaagtgcacaat
gtagaaatagtatctgtttgtttatctgcatttttgttttacaaacctgaagcagtgcct
aatatatttaaagatgtaaatgcagatcaccagcgaatgttcgaccttcttaaagaaagt
aaattaaaatggattgcaatattaccaccccattttacaaatgtacaaagatcaaaatat
gtagtaaaacatgatgagtctcctggtcggactatttccatacatgatttaggagatttt
cttattgaaagtcttcaacaaccagaacattatcaaaaagtttgtggtattgctaacatt
gcataa

DBGET integrated database retrieval system