KEGG   Bombus terrestris (buff-tailed bumblebee): 100646336Help
Entry
100646336         CDS       T04364                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00010  Glycolysis / Gluconeogenesis
bter00562  Inositol phosphate metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100646336
   00562 Inositol phosphate metabolism
    100646336
Enzymes [BR:bter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100646336
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100646336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100646336
NCBI-ProteinID: XP_012176410
AA seq 441 aa AA seqDB search
MRLLNAQVFLIINAISAAFIFAHNCLLDNRNYKCRIGTKTPYRFISNHDDSPLEYPGCIS
RKIWLILRHGTRYPGKKYVPSMIEKLPKLQKIILDNYKGNESEFTDEDIDLFKEWKITFN
KDDIMKLAEEGEDEMIDIGERYQSRFPILMPEIYDNQIYRFKYTATQRTEESAKNFATGL
FGRHSSYRVQYPEAEHKDPVLRFYKRCQRWRSEVDKNPDSRIEKEKFLKSNVYKKMLEDV
SRRIGYQVDHEIVHLMYVMCGFETAWHKNSESPWCRIFSLDEFKVLEFADDLEYYWNDGY
GYKLSYEQACPALRDVFNFFMADEGLAVSVYFSHSGTILKLLALLGIAKEDQHLTHDLFS
LYAENRAWRTGVIDTFASNIAFVLYNCSGGPSILFMHQERPLHLPGCPMNVPCPLSTMKA
LYPDQEEECQFETLCSMEESS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcgactattaaatgctcaagtatttttaattattaatgctataagtgcagcatttatc
tttgcacacaattgccttttagacaacagaaattataaatgtagaataggaactaaaaca
ccatatagatttatctcaaaccatgacgattctcctcttgaatacccaggttgtatttca
agaaaaatatggttaattttaagacatggtacaagatatcctggtaaaaagtatgtacca
tccatgattgaaaaactgccaaagttacaaaagattatcctagataactataaagggaat
gaatcagaatttacagatgaagatatagacttatttaaagagtggaaaattacttttaac
aaagatgatattatgaaattagcagaagaaggagaagatgaaatgattgatattggagaa
agatatcaatccagatttcccattcttatgccagagatttatgataatcaaatttataga
tttaagtacactgccactcaacgcacagaggaaagtgctaagaattttgctactggttta
tttggaagacacagtagttatcgagttcagtatccggaagcagaacacaaggatcctgtg
ttaagattttataaacgttgtcaacgttggcgttctgaagtggacaaaaatccagattcg
cgaatagaaaaagaaaaattcttgaagagcaatgtttataagaaaatgttagaagacgtt
tctagacgtattggttatcaggttgatcacgaaattgtacatttgatgtacgtgatgtgt
ggatttgaaactgcatggcacaaaaactccgagtcaccatggtgtagaatattttcgcta
gacgagttcaaagtactcgaatttgcagatgatttggaatattattggaacgatggatat
ggttacaaattgtcttatgagcaagcttgcccagctttgagagatgtttttaactttttt
atggcagatgaaggactggcagtatcagtgtattttagtcattcaggaaccattttgaaa
ctattagctctattagggatcgctaaggaagatcaacatttaacgcatgatttattttcg
ttatatgcggagaacagagcctggagaactggggttatcgatactttcgcatctaatatc
gcattcgttttatacaattgttctggaggtcccagtattcttttcatgcatcaggaaaga
ccattacatctaccaggttgtcctatgaatgtaccatgtccactgtctacaatgaaagca
ctttaccctgaccaagaagaggagtgtcagttcgaaacattgtgttcaatggaggaatca
tcataa

DBGET integrated database retrieval system