KEGG   Bombus terrestris (buff-tailed bumblebee): 100647107Help
Entry
100647107         CDS       T04364                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bter01002]
    100647107
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bter03110]
    100647107
Enzymes [BR:bter01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     100647107
Peptidases and inhibitors [BR:bter01002]
 Serine peptidases
  Family S8: subtilisin family
   100647107
Chaperones and folding catalysts [BR:bter03110]
 Intramolecular chaperones
  Subtilisin family
   100647107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 100647107
NCBI-ProteinID: XP_012167854
AA seq 1281 aa AA seqDB search
MAEVIDCNFPVWGLLPKKETGVTQFLAKYPEYDGRGVIIAIFDSGIDPGAPGMQETSDGK
PKIIERYDCSGAGDVDTSKIVQAPDGYIIGITGRKLKVPSNWKNPSGQYHIGVKNLYSLY
PGKLRERVLLERKKRSWDTCQKSALAEASRQLQEFEAKNPQVNSLKERLEKEELEARVEI
LNNLEKKYSDVGPTYDCIVFHDGEVWRACIDTSEEGNLEAGVFLGEYTLTREYAPLIPED
QLNISINVHDDGNTLEIAGLCSSHGTHVASIAAAYFPDNPESNGVAPGAQIISLGVGDGR
IGTMETGTAIIRAMIHVMKHKEKIHVINMSYGEHPHWSNTGRIGELMNEVIDKFGVTWVA
SAGNRGPALCTIGTPPDISTNSVISVGAYVSPDMMVAEYSLREKMPGMSYTWSSRGPMID
GGAGITVCAPGGAITSVPNFTLRKSQLMNGTSMAAPHVTGAIALLMSGLLAKGYPLSPYS
IKRALENTALYIQNLDPFAQGSGLLQVERAFDNLLTYNNVPERDIRFTINCGPNNAKGIH
MRSGVIDRSKDYAINVEPVFLNSENTDPAVKIAFNLKLTLVCDAPWVHFPTHLDLMNMVR
AFAIKIDGFNLPEGVHTTSVRAYDVTDVAKGPVFQIPITVVQPQTLPKTAVLPDLAYTNI
LFKPNTIRRHFILVPEDATWAVVRLKSTEKDKTGRFVIHSVQLKPRLSCKTLEVNKLFTV
TSQSEIVHPFAVQGGLILEVVIAKYWANIGDMLVDYFIEFHGVHIINGNLTMQSGDGINR
LEVRSSLRNEEVVPSICLKSSVQILKPTDAKIAPLRDRDIIPPSRQIYELQLTYTFHCAK
ATEVTPNAALLSDLLYESEYDSQMWMIYDTNKQLICCGDAYPSKYANQKLEKGDYTLKIH
VRHEKKDLLDRLTEMPFLLSHTLSNPISLDVYASQSQAIIGGKKMIAASVPPGHILPLYI
APLSNENNAENKVSRGAALGNASYLQGTLTFCKDDNGRKVDFHTFKYILSEPNKKSSSSS
SSSSPYHSSNKEKTTKWDEYNEALRDFKCSWLTKLAPSTKPGEYANLLYGELKNLFSDHL
PVHTAMLISLDSPEARRHVPHDDISEESVSLANQIITVADAVITNIDQDKLLAYYGLKSD
QRDDAAKIRTTMEKQKLSLIKALVKKGCALARLYVHSAKKGEGDRQSYEHLLESVTHHWQ
EVQKFAEPTDIKVIALSLWHAHINNHYGRYLKLLLRYYEDNPLKEVDEKCIELANILGWE
HLSRHIKTSIPSRYPPSYRSF
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtcattgattgtaattttcctgtttggggtcttttacctaaaaaagaaact
ggtgtcactcaatttcttgcaaaatatcctgaatatgatgggagaggagtcatcattgca
attttcgattcagggattgatcctggggctcctggtatgcaggaaacttcagatggaaag
ccaaaaattattgaaagatatgactgcagtggagctggagatgtggataccagcaaaatt
gtacaagcacctgatggatatataatagggataactggtcgtaaattaaaggttccatcc
aactggaaaaatccttctggacagtatcacataggagtaaaaaatttgtattcactatac
ccaggaaaattaagagaaagagtattattggaaagaaaaaaacgatcatgggacacatgt
caaaaatctgcacttgcagaagcatctaggcaattacaagaatttgaagcaaagaatcca
caagtaaacagtttaaaagaaaggctagaaaaagaagaacttgaagctagagttgaaata
ttaaataacctggagaaaaaatactctgatgtaggacctacttatgactgtattgttttt
catgatggtgaagtttggagagcatgcattgacacttctgaagaaggtaacttagaagct
ggtgtctttttaggcgagtacactttaacaagggaatatgcaccccttataccagaagat
caattgaatattagtattaatgtccacgacgacggaaatacgttagaaatcgctggttta
tgctcaagtcatggaacgcacgtagcttcaattgcagcagcatattttcctgataatcct
gaatcaaatggtgtagctcctggtgctcaaattatttcattaggtgtcggagatggccgc
atcggtacaatggaaacaggaactgcaataatacgtgcaatgatacatgtaatgaaacac
aaagagaaaatacatgtaattaatatgagttatggagaacatcctcattggtctaacact
gggagaataggagaattaatgaatgaagttattgataaatttggtgtaacatgggtagca
tctgctggtaatcgtggacctgctttgtgtactattggaacaccaccagatattagtact
aacagtgtgattagtgttggtgcctatgtttctcctgatatgatggtagctgaatattct
ttaagagaaaaaatgccgggcatgtcatacacgtggtcatctcgaggtccaatgatcgat
ggtggagccggaatcaccgtatgtgctccaggaggagctataactagtgttcccaatttt
acattaagaaaaagtcaactcatgaatggcacaagcatggctgctcctcatgttactgga
gctattgcattacttatgtcaggacttcttgccaaaggttatcctctttctccatatagc
ataaaaagagcgcttgaaaatacagctctatatatacaaaatctagacccttttgcacaa
gggtccgggctgttacaagtcgagcgtgcattcgataatcttcttacttacaataacgta
cctgaaagggatataagatttactattaactgtggtccaaataacgctaaaggaatccac
atgagaagcggtgttattgatcgatcaaaagattatgctattaacgttgaacctgtattc
cttaatagcgaaaatactgaccccgcagttaaaattgctttcaatttgaaattaactttg
gtatgcgatgcaccttgggtacattttccaacgcatcttgatttaatgaatatggttcgc
gcatttgctattaaaattgatggatttaatttacccgaaggtgttcatacaactagtgta
cgagcgtatgatgtaacagacgttgcaaaaggaccagtgttccaaataccaataactgta
gtgcagccacaaacactgccaaaaactgcggtccttccagacttagcatatacaaatatc
ttatttaaaccgaatacaattcgtcgacattttattctcgttcctgaagatgcaacatgg
gcggtggttagattgaagagcacagaaaaagataaaactggaagatttgtaattcatagc
gttcaactgaaaccacgtttgtcctgtaaaactcttgaagttaataagttgttcactgtt
acttctcaatcagaaattgttcatccatttgctgttcagggaggattgatcttagaagtt
gtcatcgcgaaatattgggcaaacataggtgacatgttagtggattacttcattgaattt
catggtgttcatatcataaatgggaatcttacaatgcaatctggagatggaataaatcgc
ttagaagtgcgaagttctcttagaaacgaagaagtagtgcccagtatttgccttaaatca
tccgtacaaatattaaaacccactgacgcgaagattgctcctttacgagatcgagatatt
attcctccttcacgacaaatttatgaattgcaattaacatatacgttccactgtgcaaag
gcgactgaagtaactccaaatgccgcgctgcttagcgatttattatatgaaagtgaatat
gatagtcagatgtggatgatttatgatactaataaacaacttatttgttgtggagatgcg
tacccatcaaaatatgctaatcaaaaattagagaaaggcgattatactttgaaaatacat
gtacgtcatgaaaagaaagatttacttgatagattaacggaaatgccgttccttttaagt
cacacgttaagtaatccaattagtctagatgtatatgccagtcagtcacaagccattatc
ggtggcaagaaaatgatagcagcttcagttccacccggccacattcttcctttgtatatt
gctcctttatcgaatgaaaacaacgctgaaaacaaagtttccagaggtgctgccttagga
aatgctagttacttacagggtacactgaccttctgcaaagatgataatgggaggaaggtg
gatttccatacgtttaaatatattttatctgaaccaaataaaaaatctagtagcagcagt
agtagcagtagtccctatcattcatcaaacaaagaaaaaactactaagtgggatgaatac
aacgaagcactcagggatttcaaatgcagttggcttacaaagctggcgccttctacgaaa
cctggagaatatgcaaatctactctatggagaattaaagaatctcttctctgaccatctg
cctgttcacactgccatgctaatttctttggactcacctgaagctcgacgtcatgtacca
cacgatgatatttcagaagaatctgtttctctagcaaatcaaataataactgtcgcagat
gccgtgattacaaatattgatcaagataagctcttagcctattatggcttgaagagcgat
caacgtgacgatgcagcaaaaattagaaccactatggagaaacagaaacttagcttgata
aaagcattagtaaagaaaggatgtgcattagcgcgattgtacgtacatagtgcaaaaaaa
ggagagggagatcgtcagtcatatgaacatttattagagagtgtaacacatcactggcaa
gaagtacaaaaattcgctgaaccaactgacattaaggtcattgctctttcactgtggcat
gctcacattaataatcattatggtcgttatttgaaattattgttgcgttattacgaagac
aacccattaaaagaagttgatgagaaatgtatagaacttgcaaatatcctaggatgggaa
catttgtcacgtcacattaagacaagtataccgtcgcgttatcctccttcgtacagatcg
ttttga

DBGET integrated database retrieval system