KEGG   Bombus terrestris (buff-tailed bumblebee): 100647379Help
Entry
100647379         CDS       T04364                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00450  Selenocompound metabolism
bter00970  Aminoacyl-tRNA biosynthesis
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100647379
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100647379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bter01007]
    100647379
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bter03016]
    100647379
Enzymes [BR:bter01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100647379
Amino acid related enzymes [BR:bter01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100647379
Transfer RNA biogenesis [BR:bter03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100647379
 Prokaryotic type
   Other AARSs
    100647379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 GST_C_2 Anticodon_1 tRNA-synt_1e Fez1 TMEM192
Motif
Other DBs
NCBI-GeneID: 100647379
NCBI-ProteinID: XP_020718979
AA seq 962 aa AA seqDB search
MNISTNEGNPNTLKLVIAAKVAQHAVTVKTVQPKVGFLSRLPSIELSSGLVLFSTNAAMQ
LIVPSSSQESKILNNKWLEWEISQLQPAIAFYGNTGIYKTTQKSCLWSLLRELNNALEDK
QYLIKDNNDLSLADICIWVTLWSTVMATEIGNELNKEYLSIKNWISSIELLPVIQDSIEE
YKFERGSKAIFSIQAVSWFPVNANSNPKPSKPADLQLSPTKEKEMEAVSQEEIQNISSNW
SSRSYPDVKNFPYPVLPKKGEKNILITSALPYVNNVPHLGNIIGCVLSADIFARYCRQRN
YNTLFISGTDEYGTATEAKALEEKTTPQNICDKFFDIHNDVYRWFNIGFDYFGRTTTPEQ
TEIVQSFFLKIKSEGYVLSETVDQLLCESCDRFLADRFVEGTCPRCKYEDARGDQCDGCG
HLVNATDLVSPRCKVCSNRPIVKKSQQFFLDLPKLENKLKEWSSTVEKGWSSVAKVVAKP
WLRDGLKPRCITRDLKWGIPVPVKGFENKVFYVWFDAPFGYISITKRYTKEYRQWWKPTD
VQVDLYQFMAKDNVPFHAIMFPAYLLAANEGYTLMKHLMATEYLNYEDTKFSKSRGIGVF
GTDARDTGIPADVWRFYLAYVRPETQDSNFNWVDLATKNNSELLNNFGNFVNRALVFAEK
YFDSKIPPIELQEDDLILLVLAQRELSSYIHALEQAKLRDGLKNVLAISKHGNQYMQFQE
PWVKIKGTDNDKKRAGTIIGICCNLACLLSALLAPFMPCTARELRSQLGLQTSNYGYIPD
VITSILPVGHKIGKPSPLFKKIEDKDVEILRKKYAGKQETTSSSGHGDVKSLDGAIAELD
NKVKXLKAKFDKSGWPSSQIQIFSALKKLPDLINEKNKSPESQSKKPETVLVPEQNGDVA
MDVASLEAAIAKQGDLVRQLKAKEERSVWQPEVEKLLKLKKQLGDLTGTAAAPTDKKSKK
KK
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttcaacgaacgagggcaatccgaatactttaaagctagtaattgcagctaaa
gtagcacaacatgcggttaccgtaaaaacggtacagccaaaagttggctttttgagccgt
ttaccttctattgaactttcatctgggttagtactatttagtactaatgcagcaatgcag
ctcatagtaccttcttcatctcaagagtcaaaaattcttaataataaatggttggaatgg
gaaatatctcagttacagccagctatagcattttatggtaatacagggatttacaaaacc
acacaaaagtcatgtttatggtccttattaagagaacttaataatgcgttagaagacaaa
cagtacttaattaaggataataatgacttatcattggcagatatatgtatttgggtaact
ctatggtctacagtaatggccacagaaattggaaatgaattaaataaagaatatttatca
attaaaaattggatatccagtattgaattgctgccagttatacaggattccattgaagaa
tacaaatttgaaagaggctcaaaagcaattttcagtattcaagctgtatcttggtttcct
gttaatgctaattcaaatcctaaaccttctaaaccagctgatttgcagcttagtccaact
aaagaaaaagaaatggaagcagttagtcaggaagaaatacaaaatatttcaagcaattgg
tcttctagatcatatcctgatgtaaagaactttccttatcctgtgttgccaaaaaaagga
gaaaagaatattttaataacatcagcattaccttatgtcaacaatgttcctcatttagga
aatattattggttgtgttctttctgctgatatttttgcccgatattgcagacaaagaaac
tataataccctttttattagtggtactgacgaatatggtactgctacagaagctaaagct
ttggaagagaaaacgacaccccaaaatatttgtgataaattttttgacatacataatgat
gtttatcgatggtttaatattgggtttgactattttggtcgtactactacaccagaacaa
acagaaattgtacaatcatttttcttaaaaattaaatcagaaggatatgtattaagtgaa
actgtagaccagcttctgtgcgagtcctgtgataggttcttggccgatagatttgtagaa
ggaacttgtccaaggtgtaaatatgaagatgcacgtggcgatcagtgtgatggatgcggt
catttggtgaatgcaacggatcttgtatctccgcgatgtaaagtatgtagtaatagacct
attgttaaaaagtcgcaacaattcttcttagatttaccgaagctagaaaacaagttaaaa
gaatggtcctcaacagtagaaaagggatggtcaagcgttgcaaaagtggttgcaaaaccg
tggctacgtgatggacttaaaccacgatgtataacaagagatttaaaatggggaatacct
gttccagtaaaaggttttgaaaataaagtattttacgtttggttcgacgctccttttggt
tatatcagtattacaaaaagatatacgaaggaataccgacaatggtggaagccaacggat
gtacaagttgatctataccaatttatggcaaaggacaatgttccatttcacgcaattatg
ttccctgcttatttattagcagctaatgaaggttatacattgatgaaacatttaatggca
acagaatacctcaattatgaagatacaaaattttctaaatcgagaggtatcggagtattt
ggaactgatgctagggatacaggtataccggctgatgtttggcgattttatcttgcatat
gttagacccgaaacgcaagattcgaattttaattgggtggatttagcgactaaaaataat
agtgaattattaaacaattttggaaattttgttaatagggctctagtatttgcggaaaaa
tactttgattctaagataccaccaatagaacttcaggaagatgacttaatattactggta
ttagctcagcgtgaattatcatcttatatacatgctttggaacaagctaaattacgtgat
ggtttgaaaaacgttttagcaatttcaaaacatggaaatcaatacatgcaattccaagag
ccatgggtgaaaattaaaggaacagataacgataaaaaaagagctggaacgatcatcggt
atttgctgtaacttggcatgtcttttatcagcccttttggctccgttcatgccatgcacc
gcccgcgaattaagatcccaattaggattgcaaactagtaactatggctatatacctgat
gttatcacaagcatacttcccgtgggacacaaaattggtaaaccatctccgctatttaaa
aaaatagaggataaagatgtagaaatattaagaaaaaagtatgctggtaagcaagaaact
acaagtagcagtggacacggagatgtaaaatcattggatggtgcaattgcagaattggac
aacaaagttaaanaactaaaggccaagttcgataaaagtggatggccatccagtcaaatt
caaattttctcagctttaaaaaagcttcctgatctcataaatgaaaaaaataaatcccct
gaatcgcaaagtaaaaaacctgaaacggttttggtacctgaacaaaatggagatgttgca
atggatgtagcaagtttggaagcggccatcgctaaacagggcgatcttgtacgtcaattg
aaagctaaagaagaaagatctgtatggcaaccagaagtagaaaaattattgaaactcaaa
aaacaattaggagatctcactggaacggctgcagctccgactgacaaaaagtcgaagaaa
aagaaataa

DBGET integrated database retrieval system