KEGG   Bombus terrestris (buff-tailed bumblebee): 100648955Help
Entry
100648955         CDS       T04364                                 

Definition
(RefSeq) probable peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00071  Fatty acid degradation
bter00592  alpha-Linolenic acid metabolism
bter01040  Biosynthesis of unsaturated fatty acids
bter01100  Metabolic pathways
bter01212  Fatty acid metabolism
bter04146  Peroxisome
Module
bter_M00087  beta-Oxidation
bter_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100648955
   00592 alpha-Linolenic acid metabolism
    100648955
   01040 Biosynthesis of unsaturated fatty acids
    100648955
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100648955
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100648955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M ECR1_N
Motif
Other DBs
NCBI-GeneID: 100648955
NCBI-ProteinID: XP_012172746
AA seq 670 aa AA seqDB search
MTQQRKTVHKDLQYERNRCTFDPVEVTYFLDGSPEKTKQRRDQEQYISDVLVLKENMSMR
YKSYKEVYEDSLRIARAVLSKIKKLQLSKIEEYEFVHGIFSERLGSALFQDGNPLSLHYG
MFLPTLMGQANSEQQAYWINRAWTGDVIGTYAQTELGHGTFLRGLETTATYDPETKEFVL
NSPTLTSYKWWPGGLGHTANHAIVVAQLYTQGECRGIHPFVVQLRDVETHEPLKNIIIGE
IGAKLGMNGVNNGFLGFRNYRIPRKNMLMKNSKVLEDGTYAKSENDKLTYGTMVFVRVML
LQDLLHYLSKAVTIAVRYSVVRRQGQINAEQPEVQILDYVTQQYKIFPHIATCFAIKVTA
IWLLDMYKTVQSQLHQADYKKLPELHSLSCCLKAVVSADTAAGIEQLRLSCGGHGYMTAS
NLPVLYGFATAVCTYEGENTVLLLQTARYLVKSWKQAMGGKPLPESVEYLNEAAKGVKHC
RWSNDLECLIDAYNAVAAGSIRLAAEHLDRRIRDGVPTAEAWNQTSIELTQCAEAHARVF
IVKTFANDIKQLNSKSEEFRQVMFQLCELYIVYWALRNVGNFLRFSSMQEEHVQTLHSRL
EYLLMTIRRNAVGIVDGFDFDDHILCSALGAYDGNVYERLFQEAMKSPLNRETVNIPFEK
YLKPFLKCNL
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaaagaaaaaccgtgcacaaggatctacaatatgaacgaaataggtgtacg
tttgatcctgtggaagttacctattttctcgatggtagtccagaaaaaacgaagcaacgc
cgtgatcaagaacaatatatatcggatgttctggtgttaaaagaaaatatgtcaatgaga
tataagagctataaagaagtatatgaagattctctacgaattgcccgcgctgttctttcc
aaaattaaaaaattacaactttcgaaaatagaggaatatgaatttgttcacggcatcttc
agcgaaagacttggatctgcactattccaagacggaaatccattgtctctgcattatggt
atgtttctacccacacttatgggacaagcaaattctgaacagcaagcatattggataaac
agagcttggaccggcgatgttataggaacatatgctcagactgaattaggccatggaacg
tttctcaggggtttggaaactacggcaacatacgatccggaaacgaaagagtttgttttg
aatagtccaactttgacatcttacaaatggtggccaggcggattgggccacactgcaaat
catgcaatagtcgttgcgcaattatacacccagggagaatgtaggggaattcatccgttt
gttgtacaattaagagacgtggagacacatgaacctttaaagaacattatcattggtgag
attggtgcaaaattaggaatgaacggtgtgaacaatggctttctcggatttcgtaattat
aggataccacggaagaatatgttgatgaagaattccaaggtactagaagatggaacatat
gcaaaatctgaaaatgacaagttaacgtatggtacgatggtgttcgttcgagtaatgttg
ctgcaggaccttctacactatttatccaaagctgttactattgcggttcgatacagcgta
gtaagacgtcagggtcaaataaatgcggaacaaccagaggtgcagattctcgattacgta
acgcaacaatacaaaatcttccctcatattgccacatgtttcgcaataaaagttactgcc
atttggcttttggatatgtataaaacggtacaaagtcaattgcaccaggctgattataaa
aaactaccggagttgcattctttgtcatgttgcctaaaagcagttgtatccgcagataca
gcagctggaatagagcaacttcggttatcttgtggtggacatggatacatgactgccagc
aatctgccagtactctatggatttgcgaccgcagtctgtacttacgaaggggaaaataca
gtcctacttttgcaaactgctaggtacctcgtaaaatcatggaaacaagctatgggtggt
aagccactgccagaatctgtagagtatcttaacgaagcagcgaaaggagtaaaacattgt
cgttggagtaacgatttggaatgtctgattgatgcgtataacgcggtagctgcaggatct
attcgtttagcagcagaacatttggatcgcagaatacgtgatggagttccgacggcggag
gcgtggaaccaaacgagcatcgaactaactcagtgtgcggaagctcatgctcgagtcttc
attgtaaaaacatttgcaaatgatattaaacagttaaactcgaagtctgaagaatttcgt
caagtaatgtttcaactctgcgaactgtatatcgtatattgggctttgagaaacgttggt
aattttcttcggttttcttctatgcaggaagagcatgttcagacacttcattcacgcttg
gaatatttgctgatgacaattcgtcgaaatgctgtaggaatcgtggatggtttcgatttc
gatgaccatattctttgttcggctttgggtgcttacgatggtaacgtttatgaacgattg
tttcaagaagctatgaagagccctctgaaccgtgaaactgtgaacataccttttgaaaaa
tacttaaaaccatttcttaagtgtaatttatag

DBGET integrated database retrieval system