KEGG   Bombus terrestris (buff-tailed bumblebee): 100649721Help
Entry
100649721         CDS       T04364                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bter01002]
    100649721
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bter04147]
    100649721
Enzymes [BR:bter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100649721
Peptidases [BR:bter01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100649721
Exosome [BR:bter04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100649721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Peptidase_S15 DLH Abhydrolase_3 Abhydrolase_2 Thioesterase
Motif
Other DBs
NCBI-GeneID: 100649721
NCBI-ProteinID: XP_003393000
AA seq 359 aa AA seqDB search
MQTTYLLLAALLPFAVHDIWYARIYLFWIMKVSIITYLIIFGLLPIIFHYSYTIQKKILF
LNFVQWPLNVDFSKPELVGMKGTRNFYLQTDQQVKIGLWQILPQSLLNDSIITTDDDYET
MLKNAKQPIFLYMHGNSGNRASNHRLELYKLFQTLDYHVICFDYRGYGDSEEAELSEIGV
VSDSKYVLEWLLKIVNGTAPVFVWGHSLGTGVSVHVLALLATEKVQPAGLFLESPFNNIA
DELSEHPLSQIFKHLPWFHWVIVEPFYDNYLRFESDKHIEKIQCPIMILHAEDDNIVPFA
LGEKLFKAAINYHGNDTNRIQMTRIDATHGFGHKYICRYKNLPNIIKSFVHEARKNQTD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaacttatctactattagctgcactgttacctttcgccgttcatgatatttgg
tatgcaagaatatacttattttggatcatgaaagtatcaataataacatatcttattata
tttgggcttttgcctattatatttcactactcatataccatacagaagaagattcttttt
ttaaattttgtgcaatggccacttaatgtagatttttcgaaaccagaattagttggaatg
aaaggaacaagaaacttttatttacaaactgatcaacaagtaaaaataggactatggcaa
atattacctcagtctttactaaatgattcaattattacaactgatgatgattatgaaact
atgttaaaaaatgctaaacaaccaattttcctttatatgcatggtaatagtggtaataga
gcaagcaatcatcgtttagaattatataaacttttccagactttagattatcatgttata
tgttttgattatagaggttatggtgatagtgaagaagcagaactttctgaaataggtgta
gttagtgatagtaaatatgtacttgaatggttattaaaaatagtaaatggtacagctcct
gtttttgtatggggacattcattaggaactggagtttcagttcatgtattggcattatta
gcaacagaaaaagttcagcctgcaggtttattcttggaatcaccatttaataatatagca
gatgaattaagtgaacatcctttatcacagatatttaaacatttaccatggttccattgg
gtaattgttgaaccattttatgataattatctccgttttgaatctgataaacacatagaa
aaaatccaatgtcctattatgatattacatgcagaagatgataatattgttccatttgct
ttaggtgaaaagttatttaaagcggcaataaattatcatggaaacgacacaaatcgcatt
cagatgacaaggattgatgcaacacatggttttggacataaatatatatgtcgttataaa
aatttacctaatataattaaatcatttgtacacgaggcacgtaaaaatcagactgattaa

DBGET integrated database retrieval system