KEGG   Bombus terrestris (buff-tailed bumblebee): 100649912Help
Entry
100649912         CDS       T04364                                 

Definition
(RefSeq) very long-chain-fatty-acid--CoA ligase bubblegum
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00061  Fatty acid biosynthesis
bter00071  Fatty acid degradation
bter01100  Metabolic pathways
bter01212  Fatty acid metabolism
Module
bter_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100649912
   00071 Fatty acid degradation
    100649912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bter01004]
    100649912
Enzymes [BR:bter01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     100649912
Lipid biosynthesis proteins [BR:bter01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   100649912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Motif
Other DBs
NCBI-GeneID: 100649912
NCBI-ProteinID: XP_003393002
AA seq 684 aa AA seqDB search
MNTVQPLQTNETIKEFTMNNKDIANEDSYYPSNETGLDGPDQILPADSFTTTKIDGHVRI
QLNNEDFKPISVPGLLSNTVRKYPNHIALAATPDETGHRKTYTFIEYENQIKTVAKAFLK
LGLERFHGVCILGFNSPEWLFSNLGAIYAGGIAVGIYATNTPDACQHCLQISQANIVVVE
DSKQLEKILQIRHNLPHLKAIIQYTGTPNEKDVLSWNDLIKIGEAESDDKLNEILKRIAT
NECCTLVFTSGTVGYPKAVMLSHDNLIYNVRSMNRVFKFKTACEHIISYLPLSHVAAQAI
DIYYSIYIVATLHFADRNALKGSLINTLLEVRPTIFVGVPRVWEKIYSKLQSEVNTGFIK
TCIVSWATSQGYHYNVNKMNGNDHKHWGYIFAKWLIFNKIKTALGLDRCHRCITAAAPLS
IQIKEYFLSLDIPILEAYGMSECSGGHILTAPDQFKLGSIGRTVPGLKTKLDNPDSNGEG
EVCMYGRHIFMGYLNEPEKTGEALDGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGE
NIPPVHIEELVLAELPALSNALLIGDKRKYLTILVTLKTTVNTETSEPTDDFTEETLKWL
QSIGSTSKTISDVLKTHDPLVYEEIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGEL
GPTLKLKRNVVYKKYENLIEDMYK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggtacagccgctccagacaaatgaaacgataaaagaatttacgatgaacaac
aaggatatagccaatgaagattcctattatccgagtaacgaaactggcctagatggacct
gatcaaattttgcccgctgacagtttcacgactacaaaaatagacggacatgtacgaata
caattaaataacgaagattttaaacccatatcagttcctggattattgtcaaatacagtt
agaaaatatcctaatcatatcgccctagcagcaacacctgatgaaactggtcacagaaaa
acatatacttttatcgagtatgaaaatcaaataaaaaccgtggccaaggcttttctaaaa
ttgggtttagaacgattccatggggtttgcattctaggattcaatagcccggaatggttg
ttctcaaatctcggcgctatatacgcaggagggattgctgtcggaatatatgcaaccaat
actccagatgcatgtcaacattgccttcaaattagccaggcgaacatagtagtagtcgaa
gattcaaaacaattggaaaaaatattacaaataagacacaatcttcctcatttaaaagca
attattcaatacaccggcacaccgaacgaaaaggacgttttaagttggaatgatttaata
aaaatcggagaagcagaatctgatgacaaattaaatgaaattttgaaaagaattgcaacg
aatgaatgctgtactttggttttcacgtcaggtacagttggatatccgaaggctgtaatg
ttaagtcatgacaatcttatatataatgttcgatctatgaatagagtttttaaatttaaa
accgcttgtgaacatataatctcttatttacctttatctcacgttgcagcacaggcaatc
gatatatattactccatatatatagttgctacgttacatttcgcggacaggaatgctctt
aaaggcagtttaattaatactttacttgaggtacgacctaccatatttgtaggtgtacca
agggtatgggagaaaatatactctaaactgcaaagtgaagttaatactggatttattaaa
acatgtattgtttcttgggcaacatctcaaggatatcattacaatgtaaataaaatgaat
ggtaacgatcacaaacattggggctatatctttgccaaatggctaatttttaacaaaata
aaaacagcacttggtttggatagatgtcatcgttgcattactgcagctgcccccttaagt
atacaaatcaaagaatattttttaagtttagacattcctatacttgaagcgtatggaatg
tctgaatgtagcggtggacatattttaactgcacctgatcaattcaaattaggttctatt
ggtcgaactgttcctggacttaagacaaaattagataatccagacagcaatggtgaagga
gaagtttgtatgtatggaagacacatatttatgggatatctaaatgaacctgaaaaaaca
ggggaagcattagatggagagagatggttacacagcggtgatgtagggaaaattgattca
aatggatttttacatattacaggaagaataaaagaaataattattactgctggtggagaa
aatataccaccagttcatatagaagagctagtattagctgaattgcctgcattaagcaat
gctttattaattggagacaaacgaaaatatcttaccatattagttactttaaagactaca
gttaatactgaaaccagtgaaccaacagatgacttcactgaagaaactttaaaatggtta
caatctattggaagtacatcaaaaacaatttctgatgttttaaaaacacatgatcctctt
gtatatgaagaaattgataaagcaattaaaagagccaatacgaaatctataagtaatgca
caaaaagtacagaaattccaaattttaccaaaggatttctcacttgccactggagaattg
ggaccaacacttaaacttaaaagaaatgttgtttataaaaaatatgaaaatttgatagaa
gatatgtataagtaa

DBGET integrated database retrieval system