KEGG   Bombus terrestris (buff-tailed bumblebee): 100650139Help
Entry
100650139         CDS       T04364                                 

Definition
(RefSeq) rho-associated protein kinase 2
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bter00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100650139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bter01001]
    100650139
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bter03036]
    100650139
Enzymes [BR:bter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100650139
Protein kinases [BR:bter01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100650139
Chromosome and associated proteins [BR:bter03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100650139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 Seadorna_VP7 Pkinase_C APH BRX_N
Motif
Other DBs
NCBI-GeneID: 100650139
NCBI-ProteinID: XP_003392920
AA seq 1342 aa AA seqDB search
MDVVRDEDRRRRLRVLEERVKDPRSITNIDCLLDTVQALVADCDHPSVKRMKNIEAYMNR
YDSVAQDICKMRMRTDDFTLIKVIGRGSFGEVQLVRHKSTQKVYAMKLLSKFEMIKRSDS
AFFWEERDIMAHANSQWIVQLHFAFQDQKYLYMVMDYMPGGDLVNLMSNYDVPEKWAKFY
CAEVVLALDAIHLMGFVHRDVKPDNMLLDKYGHLKLADFGTCMRMDVDGLVRSDTAVGTP
DYISPEVLQSQGGEGVYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHRNSLH
FPQEVDISHSAKNLICGFLTDRTKRLGRNGVEEIKNHPFFKNDQWTFENLRECVPPVVPE
LSGDDDTSNFEDVDKEDGPEESFPIPKAFSGNHLPFIGFTYSEDYQLMASSGKESVDGLE
NHINNGTSDDIKISQLENLLDKEKRQVESLESRQKALTTRLEAMTRRETELREEIGRADK
ELTLLRHNYKEAQRRVEHETESRRKAESLIVELKKKYDEEQTKRARDASNSQQTSERVTS
LEKQIKEMQSKLERETEMVTRLRKQATEITVARQAAEQMANELQVERAKLQAQRDNLQQE
VATLQGQLSKERSSRSQASSLTAELESRLSALHVELEHSREKEEKAIMDNRQLTEKISAL
EKEAASLTLELKAAQARYNQEVVAHQETERSRILSKEEANLEVVKALQAKLNEEKSGRQR
AELLAQEKERQTSMLSVDYRQIQQRLQKLEGEHRQEVEKVKVLQGQVEQEQQKRNILQTD
LAQQSSEAGRLRAREQQLAGEVAQLREAKRQIEDELHHLKTQRNVDQLQTKELQEQLEAE
AYFSTLYKTQTQELREELDEKIRLQQELEEERSSLVHQLQLSLARGDSEALARSIAEETV
ADLEKERTMKELEFKDGVAKHHQELNAKEQIINRLKDSEGELKKNVDQYLKEKEDLNKRF
KELQDQLSKAQSNGEEIEKLSSKLKTEQLLKQQAVNKLAEIMNRKDLSSSGKSKNKASAA
DLRKKEKDCRRLQQELTQEREKYGQLTAKWQKDLQDLQAQLVEENQAKLRLQMELDSKDS
EIETLQMKIASLNSETASVSSVENDGEDSVLSEHGTMRLEGWLNVPNKQNIKRHGWKKQY
VVVSSKKIIFYNSENDKLNADPVLILDLNKVFHVRSVTQGDVIRADAKDIPRIFQLLYAG
EGEARRPGDEGNTLPGVELPQLTDKPGTQSLKGHEFVSISYHMPTTCEVCSKQLWHMFRP
PPALECRRCRIKVHKEHLDKKEDAIAPCKLHYDPNSARELLILAGSPDEQKYWVARLSRR
VQKCGYKANSHVDGTGQRVSPR
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagtacgagatgaagacaggcgcaggcgcctgagggtgctggaggaacgagta
aaggatccaagaagtatcacaaacattgattgcttgttggatacagttcaggccctggtg
gcagattgtgatcatcccagcgtaaaacgtatgaaaaacatagaagcatatatgaataga
tatgactcagtagctcaagatatttgtaaaatgcgaatgcgtacagatgactttacccta
ataaaagtgataggtcgtggttcatttggtgaagtacaattagtaagacataaatctaca
cagaaagtatatgctatgaaattactcagtaaatttgaaatgatcaaacgatcagattca
gcctttttttgggaagaacgtgatataatggcacatgccaattctcagtggatagttcag
cttcattttgcatttcaagatcaaaaatatctttacatggtgatggattacatgccaggt
ggtgatttagtgaatttaatgtcaaattatgacgtgccagaaaaatgggcaaaattttat
tgtgcagaagtggtgcttgcattagatgcaatacatcttatgggatttgttcatagagat
gtaaagccagataatatgttacttgataagtatggtcatttaaaacttgcagattttggc
acttgtatgagaatggatgttgatggtcttgttcgatctgatactgcagtaggtacacct
gattatatatcacctgaggtgcttcagtctcaaggtggtgaaggtgtatatggaagagaa
tgtgattggtggtcagttggtgtatttttatatgaaatgcttgttggtgatactccgttt
tatgcagattcattagttgggacatattcaaaaattatggatcatagaaattcattacat
ttcccacaagaagttgatatttctcattctgccaagaatttgatatgtggttttcttacg
gatagaactaaacgtttgggtagaaatggcgtggaagaaataaaaaatcatcctttcttt
aaaaatgatcagtggacgtttgaaaatttacgagaatgtgtgcctcctgtcgtgccagaa
ctttccggcgacgatgatactagcaattttgaggatgtcgataaagaagatggaccagag
gaaagttttccaataccgaaagcattttctggaaaccatttaccttttattggttttaca
tattcagaagattatcaattaatggcttctagcggcaaggaatcggtagatggattagaa
aatcatatcaataatggtacaagcgatgatattaaaatttctcaattagaaaacttattg
gataaagaaaagagacaggtagaatctttagaatcaaggcagaaagctttaacaacacga
ttagaagctatgacacgccgggaaaccgaattgcgtgaagaaataggtagagcggacaaa
gaattgactttgttgaggcataattacaaagaagcacaacgtagggtggagcatgaaact
gagtcacgtagaaaagcggagtcattaattgtagagttgaaaaagaagtatgatgaagag
cagacgaaacgagcacgtgatgcaagtaattcacaacaaacttctgaacgtgtaacaagt
ttagaaaaacaaattaaagaaatgcaatcgaaattggaaagagaaacagaaatggtaacg
aggttacggaaacaagctactgagattactgttgctcgtcaagctgcagaacaaatggca
aatgaattacaagtggaaagagcgaaattacaagcgcaacgagataatttacagcaagaa
gtggctacattacaaggacaattgtcgaaagagcgtagttctcgatcacaagcctcatcg
ttaactgctgaattagaaagccgactctctgctctccatgtcgaactcgaacatagtcga
gagaaagaggagaaagcaatcatggataacagacaactaactgaaaaaatctcagcgttg
gaaaaagaagcagcaagtttaactcttgaattaaaagctgcgcaagctaggtataatcag
gaagtggtagcccatcaagaaacggaacgttcacgcatactatccaaagaagaagctaat
ttagaagtagttaaagcattacaagcaaaattaaatgaggaaaaaagtgggaggcaacgt
gccgaattacttgcacaagaaaaggaaaggcaaacctctatgctctctgtggattatcga
cagattcaacagcgattacagaaactggaaggagaacataggcaagaagttgaaaaggta
aaagtgttacaaggtcaggtcgaacaagaacagcagaaaagaaacattctgcagactgac
ttagcacaacagtcgtccgaagcaggacgattacgtgccagggaacaacaattagctggc
gaagttgctcagctaagagaagcgaaacgtcaaatagaggatgaactacatcatttgaaa
actcaaagaaatgtggatcaattacaaactaaggaattacaagaacaattagaagcagaa
gcttacttttcgacactttataaaacacagacgcaagaacttcgggaagaacttgatgaa
aaaatacgtttacaacaagaattagaagaagaacgtagctctttagtgcatcagttacaa
ttatctctagcgagaggtgatagtgaagctttggcaagatcaatagccgaagaaactgtc
gcagacctcgaaaaggaacgaacaatgaaggaactagaatttaaagatggagtagccaaa
catcaccaagaattgaatgcaaaagaacaaattataaatcggctcaaggatagtgaaggt
gaacttaagaaaaatgttgatcaatatcttaaagaaaaggaagatttaaataaacggttt
aaagaattgcaagatcaactttctaaagcacagtctaatggtgaagaaatagaaaaactg
agcagtaaattgaaaacggagcaattattgaaacaacaagcagttaataagttggcagag
attatgaacaggaaagatttatcttcaagcggtaaatccaagaataaagcttctgcagca
gatttaagaaagaaggaaaaagattgcagacgtttacaacaagagcttactcaagagaga
gaaaaatacggacagttaacagctaaatggcaaaaagatttgcaagatttacaagcacaa
ttagtggaagaaaatcaagcgaaattgaggttacaaatggaactcgattcgaaagattcc
gaaatagaaactttacaaatgaaaattgcttcgctcaactcagaaaccgctagcgtttcg
tccgtagaaaatgacggagaagattctgttttatcggaacatggaaccatgcgattggaa
ggttggttaaatgtgccaaataaacagaacattaaaaggcatggatggaaaaaacaatac
gttgtcgtctcttcgaagaaaataatattttataatagtgaaaatgataaattaaatgcc
gatccagtcttgatattggacctaaataaagtcttccacgttagatctgttactcagggt
gatgtcatccgagctgatgccaaagatattccgagaattttccagttattatatgctggt
gaaggcgaagcaagacgtcctggtgatgaaggaaacacactgcccggagtggaactgcca
caacttacggacaaaccaggcacgcaatcgttaaaaggtcacgaatttgtgtcaatatcg
tatcatatgccgactacttgcgaggtatgctcaaaacaattgtggcatatgtttcgaccg
ccaccagctcttgagtgccgaaggtgtcgtataaaagttcataaggagcatttggacaaa
aaggaagatgccatagcaccctgcaaattacactacgatccaaacagtgctcgtgaatta
ttaatattggctggtagtcctgacgaacagaaatattgggtcgcaagactgtctagacgt
gtacaaaaatgtggctacaaagcaaactcgcacgtcgatggcacggggcaacgtgtctcg
ccaaggtag

DBGET integrated database retrieval system